Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   9576
Gene name   psbL
Locus  
Organism   Nicotiana sylvestris
Location Start:End   66729:66613
 
Protein  
MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN
			
    Run BLAST
 
CDS  
ACGACACAATCAAACCCGAACGAACAAAATGTTGAATTGAATCGTACCAGTCTCTACTGGGGGTTATTAC
TCATTTTTGTACTTGCTGTTTTATTTTCCAATTATTTCTTCAATTAA
			
    Run BLAST
 
mRNA Edited  
 
 Edited sequence 

AC

 Other edit remarks: 

Protein sequence is in conflict with the conceptual translation