Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   402
Gene name   ycf4
Locus   AnfoCp039
Organism   Anthoceros formosae
Location Start:End   76893:77447
 
Protein  
MNWESEWFRIELIRGSRRISNFFWAFILLSGALGFLSVGLSSYFGKDLISFLSYEQIVFIPQGIVMCFYG
IAGSAFSLYLWGTIFWNIGSGYNKFDKGKGIVCIYRWGFPGKNRRIRIEFSMKDIEAIGMEVQEGFYPRR
TLRLKIKGQQDVPLTYIGENLTLREIEEEAAELARFLQISIEGF
			
    Run BLAST
 
CDS  
ATGAATTGGGAATCTGAATGGTTTCGAATAGAACTTATAAGGGGATCTTGAAGAATTAGTAATTTTTTTT
GGGCGTTCATTCTTTTGTCAGGGGCACCAGGATTTCCCCCTGTTGGACTTTCCAGTTACTTCGGTAAAGA
TTTAATATCTTTCCTATCGTATGAGTAAATCGTTTTTATTCCATAAGGAATTGTAATGTGCTTTTATGGG
ATTGCTGGTTCTGCCTTTAGCCTTTACTTGTGGGGCACCATCTTCTGGAATATAGGTAGTGGCTATAATA
AATTTGATAAAGGAAAGGGAATTGTTTGTATTTATCGTTGGGGATTTCTCGGTAAAAATCGTCGCATTCG
TATCGAATCCTCTATGAAAGATATCGAAGCTATAGGAATGGAAGTTCAGGAAGGTTTTTATCCTCGTCGC
ACTCTCCGTCTGAAAATCAAAGGTCAACAAGATGTTCCTCTAACTTATATTGGTGAAAACTTAACTTTGA
GAGAAATAGAAGAAGAAGCTGCCGAATTAGCTCGTTTTTTGCAAATATCTATTGAAGGATTTTGA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 49 U -> C 98 C -> U 107 C -> U 108 C -> U 109 C -> U 166 U -> C 184 U -> C 329 U -> C 359 C -> U
 
 Edited sequence 

AUGAAUUGGGAAUCUGAAUGGUUUCGAAUAGAACUUAUAAGGGGAUCUCGAAGAAUUAGUAAUUUUUUUU GGGCGUUCAUUCUUUUGUCAGGGGCACUAGGAUUUCUUUCUGUUGGACUUUCCAGUUACUUCGGUAAAGA UUUAAUAUCUUUCCUAUCGUAUGAGCAAAUCGUUUUUAUUCCACAAGGAAUUGUAAUGUGCUUUUAUGGG AUUGCUGGUUCUGCCUUUAGCCUUUACUUGUGGGGCACCAUCUUCUGGAAUAUAGGUAGUGGCUAUAAUA AAUUUGAUAAAGGAAAGGGAAUUGUUUGUAUUUAUCGUUGGGGAUUUCCCGGUAAAAAUCGUCGCAUUCG UAUCGAAUUCUCUAUGAAAGAUAUCGAAGCUAUAGGAAUGGAAGUUCAGGAAGGUUUUUAUCCUCGUCGC ACUCUCCGUCUGAAAAUCAAAGGUCAACAAGAUGUUCCUCUAACUUAUAUUGGUGAAAACUUAACUUUGA GAGAAAUAGAAGAAGAAGCUGCCGAAUUAGCUCGUUUUUUGCAAAUAUCUAUUGAAGGAUUUUGA