Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   400
Gene name   ycf2
Locus   AnfoCp021
Organism   Anthoceros formosae
Location Start:End   33690:40868
 
Protein  
MKQKLLENKFSYRKFKLEEIKKYEYLLNSCINWNLIKLVTGIPSNREHLIKLFDLRILSSLILRDLRKSE
MKKSLILKSFPLLILSMFIHRMNSRNIVEINNCHLERIIYGGINYREGRDEISRRYLHSFMKNFSIPLNY
PFSTKKGRERYTNNLLRQKKHIWVFKRNLLGKKYIKPVYDKIDFYNFEEWKTLIIKEILPSWKISNQSID
KANILLEDKNIEDLKHFFELYVDDIIRRDYHWKNSLDIISYRDRKNQVNFNLKNNLEFLDKKLFYCLISA
FCEKVLSEVEGPFKHKRIKSTFNLKNIEDFSDFEVTNKEIFKWELHWWKKKIFQFLDKNHESDQSIAKSF
TFFQNKRFLFLENYAEFYTWLLYEDSPFHLKKNKQLLDTAKDTFKEDSFQLNDRRNQIYSFENKGIFLNI
LHNFSIYVSNKVRKLNHLKIFSDISIKNSYLINKNLVYHGKGSGGTIYEDEKQKTWDTTDFYLKREKYFI
SKTDFLSRSIEKKCFKSNKYFLDLFLNRGDTNKRSTTESNIHSYDLSSLTKAKRKEVKSGSSYEFLEKDS
FFFLMKENFVKDFKSITKDFFSNREKKMTDYFPKLINYAFLDISSIDESNMSFHITGRHLKDFPLNEWRT
NIPSRNYMLSDISRMINLSKIRKKFQNVFFVSSISSKRIRQNKNSNDFYLISLIKLNLSWNRPYLCWSTL
YKCNKQYIFNRYLKLKERFMRGVEQLNLLITKPNQNYDKILYFQVESEIGKFHKSKENELNYNFFFPLLN
GINEDDKFLNEMFHKKVEAHSEENFETYIYPTNHRKKLKLWYELNKGSYICLDNVVKKYYSIYKLKFYLI
NRMKKLWVERIENGNSSNFIRNIVNGHSSNWKINGREWSDYNIKRDKYINWNSYIYKWFDRTKNLQIFPN
WFSDNTSRRWFNEIRFIKPDIFMTYPKKLEKNYYSKVYFIFNTSSNSLLESISKKKNINLRGRVLHNYKK
LSRDSEKLIKNKLLPESFLNKNLIKNIIISLFNNEKNHDIFREFPRKTFSLWIYKNRNNGFNSINNFQKN
LMMNFHNTNTIEFLDYLHDFHFRYDKRLPFFMKEIHIKNYDSTYNKFLRILPIYSNLRSLSINKIKPFFF
QSRIDITLSIQLQVFNDSLSNYLGRTCNYIFTSFTNHLYKLLNLLIKINSSIYKETDSCSIQKFLAMTPS
GPTILNLKITHYDEFFLGELTSNFNGYFEFSSEPNLSHTEIQSYKNELLSEFLIEFRNKNNRKLQWIKES
FLKLNLKENFKYVIGGESIDRISINLDFYEKNKNILPYPSLSITDFFDKDDKIKVSKKLYFLEKWNFFQN
YTSWFFTFEWWRYFSNIPLETFPEVLLNITDQSKYISYKTTQYIEEILKDLWKNLNFIFQTNILRKININ
SEIRLLKQINNEQHESIFIYIWSHFQFINLSNAIYLTLISLSVSCFLVSENYFSTLIGLDYIDSWRRFKV
IEYLRDPLRGSYLVERWIYGNQTQIIRTENFFMLLLKNFIHYIKNGRFFLFTRKKLDTWLFHSRTLDLSR
RKKDLLVKSVITERSLSQYRLNLNLNHNLRNYDFGYKISEKPGFYYLRYLAETYQKDLVNHSFYSSHLAE
KWILLAFWKGMISSQKLWQTKILNHESYRIPIPFELDLFSSKGILLVGPTEIGKSYLIKNLAADSYVPLI
KISISKLLYNKPDVITESWINILMESLQRLTLILELAKKMSPCIIWIQDIHELNVNRSTENVESDPTFLL
GILLKYFHTEFISKSTKGIIIIGSTHLPRKVDPALISPNRLDKLMNIRIIDIFERQEKFSILLHSKRFYF
KNKLLHFNEFAYRTMGYNGRDLVALANEVSLINTTQGNSTIYIDAVRLALHRQTLGFTYINNQMLFCQNE
GVLLHKIGKAVIQNIFIKIFPMNPLYIGSDLWKKKFYYLSEWFLEPSVTEPTIKELTLLSYILGCLAGLA
AGDSWSILEHEPENLIPLNKFIENDFDLACGISESFLVEFSWLEIFQDESINNEIEFFPKIGARHFLNMM
QRGISSTTSGKFMYKQDGLRNRSIFKKTVQYKEKLYELASETTWAPKIWRLSFIRTKSFDWIGRPNDFES
LYSFWFLREKEQTFSVSENSREIFHSSQVAQYKTKEELPYERILSRIRRRNVEELESQLGFILSEDQFKI
LGFPELSTQYRIEYELFQKPMLFMGGRFIWDPTSLSFETRYSVFSRRELFIDEEMRRRLYVTYGARRERE
RSRSSQKIKQFFLRCGYGRDFMNNSSIGWWNGLFLTEKYNIEIFKRIEEISVQLKHPEVFTPVYLYQSWL
IENSREKLSRFDLLNHRERWIKLNNKSFHYFSIHSTLLESYNYLLNFFISNRILLDEMTKMLLKDGWLFQ
NEIEHFICKMKK
			
    Run BLAST
 
CDS  
ATGAAACAGAAATTATTAGAAAACAAATTTTCATACAGGAAATTCAAATTAGAAGAAATAAAGAAATATG
AATATTTATTAAATTCATGTATTAACTGGAATTTAATCAAATTAGTAACTGGAATTCCTTCCAATCGGGA
ACATCTCATTAAGCTCTTTGACTTACGAATTCTTAGTTCATTAATTTTACGCGATTTACGTAAGTCAGAA
ATGAAAAAAAGTTTAATACTTAAGAGTTTTCCACTACTTATACTATCTATGTTTATACATCGTATGAATA
GTAGGAATATTGTTGAAATAAATAATTGTCATTTAGAGAGAATAATTTATGGAGGTATAAACTACAGAGA
AGGAAGAGATGAGATATCGAGGAGATATTTGCATTCTTTCATGAAAAATTTCTCTATTCCTTTGAATTAC
CCTTTTTCTACAAAGAAAGGACGAGAAAGATATACAAATAACTTACTAAGACAAAAAAAACATATTTGGG
TTTTTAAACGGAATCTATTAGGGAAAAAATATATAAAACCTGTATATGACAAGATTGATTTCTATAATTT
TGAAGAATGGAAAACTCTAATTATAAAAGAAATTCTTCCTAGTTGGAAAATTTCTAATCAGTCCATAGAT
AAGGCTAATATTTTATTGGAAGATAAGAATATAGAAGATTTAAAGCATTTCTTTGAATTATATGTTGATG
ATATAATTCGTAGAGACTATCATTGGAAAAACTCTCTAGACATTATCTCTTATCGTGATAGAAAGAACCA
GGTTAATTTCAATTTGAAGAATAATTTGGAATTCTTAGATAAAAAATTATTTTATTGTCTTATATCTGCT
TTTTGTGAAAAAGTTTTATCTGAAGTAGAAGGTCCATTTAAACATAAAAGAATCAAATCAACTTTCAATT
TGAAAAATATTGAAGATTTTTCGGATTTCGAAGTAACTAATAAAGAAATATTCAAATGGGAACTACACTG
GTGGAAGAAAAAAATCTTTCAATTTTTAGATAAAAATCATGAATCTGATTAGAGTATAGCCAAATCTTTT
ACTTTTTTCCAAAATAAGAGGTTTCTCTTTCTCGAAAATTATGCTGAATTTTATACATGGCTACTCTACG
AGGATTCCCCCTTTCATTTGAAAAAGAATAAGCAACTTTTGGATACTGCCAAAGATACGTTTAAAGAAGA
TTCTTTTCAATTAAATGATAGAAGAAATCAAATTTATTCTTTTGAAAATAAAGGTATATTTCTGAATATT
CTACATAATTTTTCGATTTATGTTTCAAATAAAGTAAGAAAATTGAATCATTTAAAAATATTTTCTGATA
TATCTATAAAAAATTCATATTTGATTAATAAAAATTTAGTATATCATGGAAAAGGAAGTGGTGGAACAAT
CTATGAAGATGAGAAACAAAAAACTTGGGACACTACAGATTTCTATTTGAAAAGGGAGAAATATTTCATT
TCTAAGACAGATTTTCTTTCTCGTTCTATAGAGAAGAAATGTTTCAAATCTAATAAATACTTTTTAGATT
TGTTTTTAAATAGAGGAGATACTAATAAGAGGAGTACGACAGAATCAAATATTCATTCTTACGATCTTTC
TTCTCTTACTAAAGCAAAACGAAAAGAAGTGAAATCTGGTTCCTCTTACGAATTTCTCGAAAAAGATTCT
TTCTTTTTTCTGATGAAAGAGAATTTTGTCAAAGATTTTAAGTCTATCACAAAAGATTTTTTCTCCAATA
GAGAAAAAAAAATGACTGATTATTTTCCAAAATTGATTAATTATGCTTTTTTGGACATATCGTCAATAGA
TGAATCTAATATGAGTTTTCATATAACTGGAAGACATTTAAAAGATTTTCCATTAAATGAGTGGCGAACT
AATATCCCGTCAAGAAATTACATGCTATCAGATATTAGTAGAATGATTAATCTATCGAAGATAAGAAAAA
AATTTCAAAACGTTTTTTTTGTTTCTTCAATATCAAGTAAGAGGATTCGGCAAAATAAAAATTCAAACGA
TTTTTATTTAATTTCACTTATAAAACTGAATTTGTCTTGGAATCGCCCTTATTTATGTTGGTCAACCCTT
TACAAATGCAACAAACAATACATATTCAATAGGTATCTCAAATTGAAGGAAAGATTCATGAGAGGAGTAG
AACAATTAAATTTATTAATCACTAAACCTAATCAGAATTATGATAAAATACTTTATTTTTAGGTGGAAAG
TGAAATAGGTAAATTTCATAAATCAAAAGAAAATGAATTAAATTATAATTTTTTTTTTCCTTTGTTGAAT
GGTATTAATGAAGATGATAAATTTCTTAATGAAATGTTTCACAAAAAAGTAGAAGCTCATTCTGAAGAAA
ATTTTGAAACCTATATCTACCCAACGAATCATAGGAAGAAATTAAAATTGTGGTACGAGTTAAATAAAGG
AAGTTACATATGCCTCGATAATGTAGTAAAAAAATATTACTCTATATATAAATTAAAGTTTTATTTAATA
AATAGAATGAAGAAACTTTGGGTAGAAAGGATAGAGAATGGAAATTCAAGTAACTTTATATGAAATATAG
TCAACGGACATTCATCCAATTGGAAAATAAATGGGAGAGAATGGTCTGATTATAATATCAAACGTGACAA
ATATATTAATTGGAATTCGTACATATATAAATGGTTTGATAGGACTAAAAATTTGCAAATTTTTCCTAAT
TGGTTTTCTGATAATACTTCAAGGAGATGGTTCAATGAAATAAGATTTATCAAACCTGATATTTTTATGA
CGTACCCTAAAAAACTTGAGAAGAATTATTATTCGAAAGTCTATTTCATTTTTAATACTTCATCAAATTC
CCTATTAGAATCTATTTCTAAAAAAAAGAATATAAATTTGAGAGGAAGAGTTTTACATAATTATAAAAAA
TTATCACGAGATTCAGAAAAATTGATTAAGAATAAATTGCTACCAGAATCATTTCTTAATAAAAATTTAA
TAAAGAATATTATTATTTCTCTTTTTAATAATGAAAAAAATCATGATATTTTTAGAGAATTTCCTAGAAA
AACTTTTTCTCTTTGGATATATAAGAATCGAAATAATGGCTTCAATTCAATCAATAATTTTCAAAAAAAT
TTGATGATGAATTTTCATAACACTAATACCATAGAATTTCTAGATTATTTACATGACTTTCATTTTAGAT
ACGACAAAAGATTACCCTTTTTTATGAAAGAAATTCATATTAAAAATTACGATTCTACATATAATAAATT
TTTAAGAATTTTGCCTATATATAGTAATCTTCGTTCTCTGTCTATCAATAAAATAAAACCATTTTTTTTT
CAATCGAGAATAGATATTACTCTATCTATTTAATTACAAGTGTTTAACGATTCATTATCTAATTATTTAG
GAAGAACTTGTAACTATATTTTTACTTCTTTCACTAATCACCTATATAAATTGTTGAATCTATTAATCAA
GATTAATTCATCTATTTACAAAGAAACAGATAGTTGTTCCATCCAAAAATTTTTAGCTATGACTCCTTCG
GGGCCAACGATACTGAATTTAAAAATAACTCATTATGATGAATTCTTTTTGGGAGAATTAACAAGTAACT
TCAATGGATACTTTGAATTTTCTTCCGAACCAAATCTAAGTCATACCGAAATTCAATCTTATAAAAATGA
ATTATTGTCTGAATTTCTTATTGAATTTCGGAATAAGAATAATAGGAAACTTTAATGGATCAAGGAATCA
TTTCTGAAGTTAAATTTAAAAGAAAATTTTAAATATGTTATTGGAGGAGAATCTATAGATAGAATAAGCA
TAAATCTAGATTTCTATGAAAAGAATAAGAATATATTACCCTATCCTTCATTAAGCATAACTGATTTTTT
TGATAAAGATGATAAAATTAAAGTGTCTAAAAAACTTTATTTCTTGGAGAAATGGAATTTCTTTCAAAAT
TACACTTCATGGTTTTTCACGTTTGAATGGTGGAGGTATTTCAGTAATATACCCCTAGAAACGTTCCCAG
AAGTATTACTAAATATTACTGATCAATCTAAATATATTTCATATAAGACTACGCAATATATAGAAGAAAT
TTTGAAAGATTTATGGAAAAATCTAAATTTTATTTTCCAAACTAATATTCTAAGGAAAATTAATATAAAT
TCAGAAATACGTTTATTGAAACAAATTAATAATGAGCAACATGAATCAATATTTATATATATATGGTCAC
ATTTCCAATTTATTAATCTTTCGAATGCTATATATTTAACTTTAATAAGCTTATCTGTTTCTTGCTTTTT
AGTCTCTGAAAATTACTTCTCTACTTTGATAGGTTTAGATTATATCGATTCATGGAGACGCTTCAAAGTA
ATTGAATACTTAAGAGATCCATTGAGAGGATCTTACTTAGTAGAAAGATGGATATATGGAAATCAAACTC
AAATCATTAGAACGGAAAATTTTTTCATGCTTCTTCTGAAAAATTTTATCCATTATATAAAAAATGGAAG
ATTTTTCTTATTTACCAGAAAAAAATTGGATACATGGTTATTTCATAGTAGAACTTTAGACCTTTCTAGA
AGAAAAAAAGATTTACTAGTTAAATCTGTAATCACGGAAAGAAGTCTTTCGCAATATAGATTGAATTTAA
ATTTAAATCATAATTTAAGAAATTACGATTTCGGTTATAAAATCTCTGAAAAACCGGGATTTTATTATTT
GAGATATTTAGCAGAAACTTATCAGAAAGATTTAGTCAATCATTCTTTTTATTCTTCTCACTTAGCTGAA
AAATGGATTTTACTAGCTTTTTGGAAAGGAATGATCTCTTCACAGAAATTGTGGCAAACGAAAATACTGA
ATCACGAATCTTACAGAATACCAATTCCATTCGAATTGGATTTATTTTCTTCTAAAGGAATTTTACTTGT
AGGTCCTACGGAAATAGGAAAATCTTACTTAATAAAAAATTTAGCGGCAGATTCTTATGTTCCTTTAATA
AAAATATCTATCAGCAAACCTTTGTATAACAAACCAGATGTTATAACTGAAAGTTGGATAAATATTTTGA
TGGAAAGTCTTCAAAGATTAACTCTTATTTTGGAATTAGCAAAAAAAATGTCCCCCTGTATAATATGGAT
TCAAGATATCCATGAGTTAAATGTGAATCGTTCAACCGAAAATGTAGAATCTGATCCGACTTCTTTACTT
GGTATCTTATTGAAATATTTCCATACTGAATTTATTAGCAAAAGTACCAAAGGTATAATAATTATCGGTT
CTACTCATCTTCCTAGAAAAGTTGATCCAGCTTTAATTTCTCCAAATAGATTGGATAAATTGATGAATAT
ACGAATAATTGATATATTTGAATGACAAGAAAAATTTTCTATTCTTCTACATAGTAAACGTTTTTATTTT
AAAAATAAGTTGCTTCATTTTAACGAGTTTGCATATAGAACTATGGGTTATAATGGAAGAGATTTAGTAG
CACTTGCTAACGAAGTTTCATTAATTAATACTACTCAGGGTAATTCAACTATTTACATTGATGCAGTAAG
ATTAGCGCTCCATAGACAAACTTTAGGTTTTACATATATCAATAATCAAATGTTATTTTGTCAGAATGAA
GGAGTACTTCTTCATAAAATAGGAAAAGCTGTTATACAAAATATATTTATAAAAATTTTTCCTATGAATC
CTTTATATATAGGTAGTGACTTATGGAAGAAGAAGTTTTATTATTTGTCCGAATGGTTTTTGGAACCTTC
TGTGACCGAACCCACCATAAAGGAATTAACTTTATTATCTTATATTCTCGGTTGCTTAGCTGGATTAGCA
GCTGGAGATTCCTGGTCTATTTTAGAACATGAACCAGAAAATTTAATTCCTCTCAATAAATTTATTGAGA
ATGATTTCGATTTAGCTTGTGGTATTTCAGAAAGTTTCCTAGTAGAGTTTTCTTGGTTAGAAATATTTCA
AGATGAATCTATTAATAATGAAATCGAATTTTTTCCTAAAATTGGGGCAAGACATTTCTTGAATATGATG
CAAAGAGGAATTTCTTCCACGACAAGTGGAAAATTCATGTATAAACAAGATGGACTACGAAATAGATCTA
TATTTAAGAAAACGGTTCAGTATAAGGAAAAGCTATATGAATTAGCAAGTGAAACAACTTGGGCTCCTAA
AATATGGCGTCTTAGTTTCATCAGAACTAAATCATTCGATTGGATAGGAAGACCCAATGATTTTGAATCT
TTGTATAGCTTCTGGTTTCTCAGAGAAAAAGAACAAACTTTTTCCGTTTCTGAAAATTCACGAGAAATTT
TTCATTCCAGTCAGGTTGCGCAGTACAAAACAAAAGAAGAACTCCCTTATGAAAGAATTCTATCTAGAAT
AAGACGGAGGAATGTGGAGGAATTAGAGTCTTAATTAGGTTTTATTTTATCGGAAGATCAATTTAAAATA
TTAGGATTTCCCGAATTATCTACGCAATATAGAATAGAATATGAATTATTTCAAAAACCAATGTTGTTTA
TGGGAGGACGATTCATTTGGGATCCCACCAGTCTATCATTTGAAACTCGTTACTCTGTTTTTTCACGCCG
AGAATTATTCATAGATGAAGAAATGCGAAGAAGACTTTATGTTACTTATGGGGCAAGACGCGAGCGAGAA
AGATCTCGTTCAAGTCAAAAGATCAAACAGTTTTTTCTTCGTTGCGGATATGGTCGAGATTTCATGAATA
ATTCATCTATTGGTTGGTGGAATGGACTATTTCTTACAGAGAAATATAATATTGAGATCTTTAAACGCAT
CGAAGAAATTAGTGTTCAATTGAAGCATCCCGAAGTATTTACTCCTGTATATTTGTATTAAAGTTGGTTG
ATTGAAAATTCGAGAGAGAAACTTTCCCGTTTTGACTTATTGAATCATCGCGAAAGATGGATCAAATTGA
ATAATAAATCATTCCATTATTTTTCCATTCATAGTACTTTATTAGAAAGTTATAACTATTTATTGAATTT
CTTTATATCGAACAGAATATTATTAGATGAAATGACAAAAATGTTATTAAAAGATGGATGGCTCTTTCAA
AATGAAATTGAACATTTTATTTGTAAAATGAAGAAATAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 1030 U -> C 2230 U -> C 2581 U -> C 3391 U -> C 3763 U -> C 5060 C -> U 5243 C -> U 5413 U -> C 6472 U -> C 6919 U -> C
 
 Edited sequence 

AUGAAACAGAAAUUAUUAGAAAACAAAUUUUCAUACAGGAAAUUCAAAUUAGAAGAAAUAAAGAAAUAUG AAUAUUUAUUAAAUUCAUGUAUUAACUGGAAUUUAAUCAAAUUAGUAACUGGAAUUCCUUCCAAUCGGGA ACAUCUCAUUAAGCUCUUUGACUUACGAAUUCUUAGUUCAUUAAUUUUACGCGAUUUACGUAAGUCAGAA AUGAAAAAAAGUUUAAUACUUAAGAGUUUUCCACUACUUAUACUAUCUAUGUUUAUACAUCGUAUGAAUA GUAGGAAUAUUGUUGAAAUAAAUAAUUGUCAUUUAGAGAGAAUAAUUUAUGGAGGUAUAAACUACAGAGA AGGAAGAGAUGAGAUAUCGAGGAGAUAUUUGCAUUCUUUCAUGAAAAAUUUCUCUAUUCCUUUGAAUUAC CCUUUUUCUACAAAGAAAGGACGAGAAAGAUAUACAAAUAACUUACUAAGACAAAAAAAACAUAUUUGGG UUUUUAAACGGAAUCUAUUAGGGAAAAAAUAUAUAAAACCUGUAUAUGACAAGAUUGAUUUCUAUAAUUU UGAAGAAUGGAAAACUCUAAUUAUAAAAGAAAUUCUUCCUAGUUGGAAAAUUUCUAAUCAGUCCAUAGAU AAGGCUAAUAUUUUAUUGGAAGAUAAGAAUAUAGAAGAUUUAAAGCAUUUCUUUGAAUUAUAUGUUGAUG AUAUAAUUCGUAGAGACUAUCAUUGGAAAAACUCUCUAGACAUUAUCUCUUAUCGUGAUAGAAAGAACCA GGUUAAUUUCAAUUUGAAGAAUAAUUUGGAAUUCUUAGAUAAAAAAUUAUUUUAUUGUCUUAUAUCUGCU UUUUGUGAAAAAGUUUUAUCUGAAGUAGAAGGUCCAUUUAAACAUAAAAGAAUCAAAUCAACUUUCAAUU UGAAAAAUAUUGAAGAUUUUUCGGAUUUCGAAGUAACUAAUAAAGAAAUAUUCAAAUGGGAACUACACUG GUGGAAGAAAAAAAUCUUUCAAUUUUUAGAUAAAAAUCAUGAAUCUGAUCAGAGUAUAGCCAAAUCUUUU ACUUUUUUCCAAAAUAAGAGGUUUCUCUUUCUCGAAAAUUAUGCUGAAUUUUAUACAUGGCUACUCUACG AGGAUUCCCCCUUUCAUUUGAAAAAGAAUAAGCAACUUUUGGAUACUGCCAAAGAUACGUUUAAAGAAGA UUCUUUUCAAUUAAAUGAUAGAAGAAAUCAAAUUUAUUCUUUUGAAAAUAAAGGUAUAUUUCUGAAUAUU CUACAUAAUUUUUCGAUUUAUGUUUCAAAUAAAGUAAGAAAAUUGAAUCAUUUAAAAAUAUUUUCUGAUA UAUCUAUAAAAAAUUCAUAUUUGAUUAAUAAAAAUUUAGUAUAUCAUGGAAAAGGAAGUGGUGGAACAAU CUAUGAAGAUGAGAAACAAAAAACUUGGGACACUACAGAUUUCUAUUUGAAAAGGGAGAAAUAUUUCAUU UCUAAGACAGAUUUUCUUUCUCGUUCUAUAGAGAAGAAAUGUUUCAAAUCUAAUAAAUACUUUUUAGAUU UGUUUUUAAAUAGAGGAGAUACUAAUAAGAGGAGUACGACAGAAUCAAAUAUUCAUUCUUACGAUCUUUC UUCUCUUACUAAAGCAAAACGAAAAGAAGUGAAAUCUGGUUCCUCUUACGAAUUUCUCGAAAAAGAUUCU UUCUUUUUUCUGAUGAAAGAGAAUUUUGUCAAAGAUUUUAAGUCUAUCACAAAAGAUUUUUUCUCCAAUA GAGAAAAAAAAAUGACUGAUUAUUUUCCAAAAUUGAUUAAUUAUGCUUUUUUGGACAUAUCGUCAAUAGA UGAAUCUAAUAUGAGUUUUCAUAUAACUGGAAGACAUUUAAAAGAUUUUCCAUUAAAUGAGUGGCGAACU AAUAUCCCGUCAAGAAAUUACAUGCUAUCAGAUAUUAGUAGAAUGAUUAAUCUAUCGAAGAUAAGAAAAA AAUUUCAAAACGUUUUUUUUGUUUCUUCAAUAUCAAGUAAGAGGAUUCGGCAAAAUAAAAAUUCAAACGA UUUUUAUUUAAUUUCACUUAUAAAACUGAAUUUGUCUUGGAAUCGCCCUUAUUUAUGUUGGUCAACCCUU UACAAAUGCAACAAACAAUACAUAUUCAAUAGGUAUCUCAAAUUGAAGGAAAGAUUCAUGAGAGGAGUAG AACAAUUAAAUUUAUUAAUCACUAAACCUAAUCAGAAUUAUGAUAAAAUACUUUAUUUUCAGGUGGAAAG UGAAAUAGGUAAAUUUCAUAAAUCAAAAGAAAAUGAAUUAAAUUAUAAUUUUUUUUUUCCUUUGUUGAAU GGUAUUAAUGAAGAUGAUAAAUUUCUUAAUGAAAUGUUUCACAAAAAAGUAGAAGCUCAUUCUGAAGAAA AUUUUGAAACCUAUAUCUACCCAACGAAUCAUAGGAAGAAAUUAAAAUUGUGGUACGAGUUAAAUAAAGG AAGUUACAUAUGCCUCGAUAAUGUAGUAAAAAAAUAUUACUCUAUAUAUAAAUUAAAGUUUUAUUUAAUA AAUAGAAUGAAGAAACUUUGGGUAGAAAGGAUAGAGAAUGGAAAUUCAAGUAACUUUAUACGAAAUAUAG UCAACGGACAUUCAUCCAAUUGGAAAAUAAAUGGGAGAGAAUGGUCUGAUUAUAAUAUCAAACGUGACAA AUAUAUUAAUUGGAAUUCGUACAUAUAUAAAUGGUUUGAUAGGACUAAAAAUUUGCAAAUUUUUCCUAAU UGGUUUUCUGAUAAUACUUCAAGGAGAUGGUUCAAUGAAAUAAGAUUUAUCAAACCUGAUAUUUUUAUGA CGUACCCUAAAAAACUUGAGAAGAAUUAUUAUUCGAAAGUCUAUUUCAUUUUUAAUACUUCAUCAAAUUC CCUAUUAGAAUCUAUUUCUAAAAAAAAGAAUAUAAAUUUGAGAGGAAGAGUUUUACAUAAUUAUAAAAAA UUAUCACGAGAUUCAGAAAAAUUGAUUAAGAAUAAAUUGCUACCAGAAUCAUUUCUUAAUAAAAAUUUAA UAAAGAAUAUUAUUAUUUCUCUUUUUAAUAAUGAAAAAAAUCAUGAUAUUUUUAGAGAAUUUCCUAGAAA AACUUUUUCUCUUUGGAUAUAUAAGAAUCGAAAUAAUGGCUUCAAUUCAAUCAAUAAUUUUCAAAAAAAU UUGAUGAUGAAUUUUCAUAACACUAAUACCAUAGAAUUUCUAGAUUAUUUACAUGACUUUCAUUUUAGAU ACGACAAAAGAUUACCCUUUUUUAUGAAAGAAAUUCAUAUUAAAAAUUACGAUUCUACAUAUAAUAAAUU UUUAAGAAUUUUGCCUAUAUAUAGUAAUCUUCGUUCUCUGUCUAUCAAUAAAAUAAAACCAUUUUUUUUU CAAUCGAGAAUAGAUAUUACUCUAUCUAUUCAAUUACAAGUGUUUAACGAUUCAUUAUCUAAUUAUUUAG GAAGAACUUGUAACUAUAUUUUUACUUCUUUCACUAAUCACCUAUAUAAAUUGUUGAAUCUAUUAAUCAA GAUUAAUUCAUCUAUUUACAAAGAAACAGAUAGUUGUUCCAUCCAAAAAUUUUUAGCUAUGACUCCUUCG GGGCCAACGAUACUGAAUUUAAAAAUAACUCAUUAUGAUGAAUUCUUUUUGGGAGAAUUAACAAGUAACU UCAAUGGAUACUUUGAAUUUUCUUCCGAACCAAAUCUAAGUCAUACCGAAAUUCAAUCUUAUAAAAAUGA AUUAUUGUCUGAAUUUCUUAUUGAAUUUCGGAAUAAGAAUAAUAGGAAACUUCAAUGGAUCAAGGAAUCA UUUCUGAAGUUAAAUUUAAAAGAAAAUUUUAAAUAUGUUAUUGGAGGAGAAUCUAUAGAUAGAAUAAGCA UAAAUCUAGAUUUCUAUGAAAAGAAUAAGAAUAUAUUACCCUAUCCUUCAUUAAGCAUAACUGAUUUUUU UGAUAAAGAUGAUAAAAUUAAAGUGUCUAAAAAACUUUAUUUCUUGGAGAAAUGGAAUUUCUUUCAAAAU UACACUUCAUGGUUUUUCACGUUUGAAUGGUGGAGGUAUUUCAGUAAUAUACCCCUAGAAACGUUCCCAG AAGUAUUACUAAAUAUUACUGAUCAAUCUAAAUAUAUUUCAUAUAAGACUACGCAAUAUAUAGAAGAAAU UUUGAAAGAUUUAUGGAAAAAUCUAAAUUUUAUUUUCCAAACUAAUAUUCUAAGGAAAAUUAAUAUAAAU UCAGAAAUACGUUUAUUGAAACAAAUUAAUAAUGAGCAACAUGAAUCAAUAUUUAUAUAUAUAUGGUCAC AUUUCCAAUUUAUUAAUCUUUCGAAUGCUAUAUAUUUAACUUUAAUAAGCUUAUCUGUUUCUUGCUUUUU AGUCUCUGAAAAUUACUUCUCUACUUUGAUAGGUUUAGAUUAUAUCGAUUCAUGGAGACGCUUCAAAGUA AUUGAAUACUUAAGAGAUCCAUUGAGAGGAUCUUACUUAGUAGAAAGAUGGAUAUAUGGAAAUCAAACUC AAAUCAUUAGAACGGAAAAUUUUUUCAUGCUUCUUCUGAAAAAUUUUAUCCAUUAUAUAAAAAAUGGAAG AUUUUUCUUAUUUACCAGAAAAAAAUUGGAUACAUGGUUAUUUCAUAGUAGAACUUUAGACCUUUCUAGA AGAAAAAAAGAUUUACUAGUUAAAUCUGUAAUCACGGAAAGAAGUCUUUCGCAAUAUAGAUUGAAUUUAA AUUUAAAUCAUAAUUUAAGAAAUUACGAUUUCGGUUAUAAAAUCUCUGAAAAACCGGGAUUUUAUUAUUU GAGAUAUUUAGCAGAAACUUAUCAGAAAGAUUUAGUCAAUCAUUCUUUUUAUUCUUCUCACUUAGCUGAA AAAUGGAUUUUACUAGCUUUUUGGAAAGGAAUGAUCUCUUCACAGAAAUUGUGGCAAACGAAAAUACUGA AUCACGAAUCUUACAGAAUACCAAUUCCAUUCGAAUUGGAUUUAUUUUCUUCUAAAGGAAUUUUACUUGU AGGUCCUACGGAAAUAGGAAAAUCUUACUUAAUAAAAAAUUUAGCGGCAGAUUCUUAUGUUCCUUUAAUA AAAAUAUCUAUCAGCAAACUUUUGUAUAACAAACCAGAUGUUAUAACUGAAAGUUGGAUAAAUAUUUUGA UGGAAAGUCUUCAAAGAUUAACUCUUAUUUUGGAAUUAGCAAAAAAAAUGUCCCCCUGUAUAAUAUGGAU UCAAGAUAUCCAUGAGUUAAAUGUGAAUCGUUCAACCGAAAAUGUAGAAUCUGAUCCGACUUUUUUACUU GGUAUCUUAUUGAAAUAUUUCCAUACUGAAUUUAUUAGCAAAAGUACCAAAGGUAUAAUAAUUAUCGGUU CUACUCAUCUUCCUAGAAAAGUUGAUCCAGCUUUAAUUUCUCCAAAUAGAUUGGAUAAAUUGAUGAAUAU ACGAAUAAUUGAUAUAUUUGAACGACAAGAAAAAUUUUCUAUUCUUCUACAUAGUAAACGUUUUUAUUUU AAAAAUAAGUUGCUUCAUUUUAACGAGUUUGCAUAUAGAACUAUGGGUUAUAAUGGAAGAGAUUUAGUAG CACUUGCUAACGAAGUUUCAUUAAUUAAUACUACUCAGGGUAAUUCAACUAUUUACAUUGAUGCAGUAAG AUUAGCGCUCCAUAGACAAACUUUAGGUUUUACAUAUAUCAAUAAUCAAAUGUUAUUUUGUCAGAAUGAA GGAGUACUUCUUCAUAAAAUAGGAAAAGCUGUUAUACAAAAUAUAUUUAUAAAAAUUUUUCCUAUGAAUC CUUUAUAUAUAGGUAGUGACUUAUGGAAGAAGAAGUUUUAUUAUUUGUCCGAAUGGUUUUUGGAACCUUC UGUGACCGAACCCACCAUAAAGGAAUUAACUUUAUUAUCUUAUAUUCUCGGUUGCUUAGCUGGAUUAGCA GCUGGAGAUUCCUGGUCUAUUUUAGAACAUGAACCAGAAAAUUUAAUUCCUCUCAAUAAAUUUAUUGAGA AUGAUUUCGAUUUAGCUUGUGGUAUUUCAGAAAGUUUCCUAGUAGAGUUUUCUUGGUUAGAAAUAUUUCA AGAUGAAUCUAUUAAUAAUGAAAUCGAAUUUUUUCCUAAAAUUGGGGCAAGACAUUUCUUGAAUAUGAUG CAAAGAGGAAUUUCUUCCACGACAAGUGGAAAAUUCAUGUAUAAACAAGAUGGACUACGAAAUAGAUCUA UAUUUAAGAAAACGGUUCAGUAUAAGGAAAAGCUAUAUGAAUUAGCAAGUGAAACAACUUGGGCUCCUAA AAUAUGGCGUCUUAGUUUCAUCAGAACUAAAUCAUUCGAUUGGAUAGGAAGACCCAAUGAUUUUGAAUCU UUGUAUAGCUUCUGGUUUCUCAGAGAAAAAGAACAAACUUUUUCCGUUUCUGAAAAUUCACGAGAAAUUU UUCAUUCCAGUCAGGUUGCGCAGUACAAAACAAAAGAAGAACUCCCUUAUGAAAGAAUUCUAUCUAGAAU AAGACGGAGGAAUGUGGAGGAAUUAGAGUCUCAAUUAGGUUUUAUUUUAUCGGAAGAUCAAUUUAAAAUA UUAGGAUUUCCCGAAUUAUCUACGCAAUAUAGAAUAGAAUAUGAAUUAUUUCAAAAACCAAUGUUGUUUA UGGGAGGACGAUUCAUUUGGGAUCCCACCAGUCUAUCAUUUGAAACUCGUUACUCUGUUUUUUCACGCCG AGAAUUAUUCAUAGAUGAAGAAAUGCGAAGAAGACUUUAUGUUACUUAUGGGGCAAGACGCGAGCGAGAA AGAUCUCGUUCAAGUCAAAAGAUCAAACAGUUUUUUCUUCGUUGCGGAUAUGGUCGAGAUUUCAUGAAUA AUUCAUCUAUUGGUUGGUGGAAUGGACUAUUUCUUACAGAGAAAUAUAAUAUUGAGAUCUUUAAACGCAU CGAAGAAAUUAGUGUUCAAUUGAAGCAUCCCGAAGUAUUUACUCCUGUAUAUUUGUAUCAAAGUUGGUUG AUUGAAAAUUCGAGAGAGAAACUUUCCCGUUUUGACUUAUUGAAUCAUCGCGAAAGAUGGAUCAAAUUGA AUAAUAAAUCAUUCCAUUAUUUUUCCAUUCAUAGUACUUUAUUAGAAAGUUAUAACUAUUUAUUGAAUUU CUUUAUAUCGAACAGAAUAUUAUUAGAUGAAAUGACAAAAAUGUUAUUAAAAGAUGGAUGGCUCUUUCAA AAUGAAAUUGAACAUUUUAUUUGUAAAAUGAAGAAAUAA