Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   398
Gene name   ycf10
Locus   AnfoCp040
Organism   Anthoceros formosae
Location Start:End   77577:79103
 
Protein  
MKLYQWQIFRWFFETLNCSLGRAYKASKRIQYIKKDYSFYKNTILFSKGSWQAINLYTNTELRNTLFIIY
WSLLEYRISLCFLNLLRKIESIQFKKLSVISFILNLHSSLSHVNKQLQILSKVLFDRFYFYLWKNMYFSL
LLHNSLSRFVKESIEESEQSGFNNENKKDFQDETYFVLNESLEKDFSRIREMNRKLAWIEVTLNDLNTWK
SYYLFFPFLSEMKNTPQNESSFKLKNFEITTPAYDSTGFIPRSISRTLSRFQIELMGQSSSLVLQEFRSA
KYQALASIQYIGCLIFLPWIISRSLKEWFLEPWIKFWWDTYQSQISLNSFQEERASEGLQEVEEPLWLDK
LVSNFLKNQSQDLNIEIYGETIQLIRMYNENSIQTILHLLTGMICFTTLGALFILGKKRLSVLNSWIQES
FYSLSDTMKAFAILLLTDLCIGFHSPHGWEVVIGSSLEHLGFAHNKHIISCFVSTFPVILDTVSKYWIFR
HLNRISPSIVATYHTMNE
			
    Run BLAST
 
CDS  
ATGAAATTATATCAGTGGCAAATTCTTCGATGGTTTTTTGAGACTCTAAATTGTTCTTTAGGAAGAGCTT
ATAAGGCTAGCAAAAGAATACAGTATATAAAGAAAGATTATTCATTCTATAAAAATACCATCTTATTTTC
AAAAGGTTCTTGGCAAGCTATAAATCTTTATACGAATACAGAATTGAGAAACACTTTATTTATAATCTAC
TGGAGTCTTTTAGAATATAGAATTAGCCTGTGTTTCTTAAATTTACTAAGGAAAATTGAATTTATTCAAT
TTAAAAAATTATCCGTTATTTCTTTTATTCTTAATTTACATTCATCTCTTTCTCATGTTAACAAACAGCT
TCAAATTCTACCAAAAGTTCTTTTTGATAGATTTTATTTTTATCTTTGGAAAAACATGTATTTTTCCCTT
CTTCTCCACAATTCCCTTTCAAGATTCGTAAAGGAGAGTATAGAAGAATCAGAGCAGAGTGGATTCAACA
ACGAAAACAAAAAAGATTTTCAAGATGAAACTTATTTTGTTTTAAATGAATCCCTTGAGAAAGATTTTAG
TAGAATAAGAGAGATGAATAGAAAATTGGCTTGGATTGAAGTAACTTTAAATGATTTAAATACTTGGAAG
AGTTACTACCTCTTCTTCCCATTTTTATCAGAGATGAAGAATACTCCTCAAAATGAATCTTCTTTTAAGT
TGAAGAATTTTGAAATAACGACTCCAGCTTATGATTCTACAGGTTTTATACTATGTTCCATAAGTCGTAC
TTTATCTAGATTTCAAATAGAATTGATGGGTTAGTCAAGTTCATTGGTACTTCAGGAATTTCGATCAGCT
AAATATCAAGCATTGGCATCTATACAATATATAGGATGTTTAATTTTTCTTCCTCGGATAATTTCCCGCT
CTCTCAAGGAATGGTTTTTGGAACCCTGGATTAAATTTTGGTGGGATACTTATCAATCTTAAATTTCTCT
TAATTCTTTCCAAGAAGAAAGAGCATCAGAAGGGCTTCAAGAAGTCGAAGAACCACTTTGGTTGGATAAA
TTGGTGTCAAATTTTCTGAAAAATCAATCCCAAGACCTTAATATAGAAATTTATGGAGAAACAATTCAAT
TAATAAGAATGTACAATGAAAATAGTATTCAAACCATTTTACATTTATTAACAGGTATGATTTGCTTCAC
TACTTTAGGTGCCTTGTTTATCTTAGGTAAGAAAAGGCTTTCTGTTTTGAATTCCTGGATTCAAGAATCA
TTTTATAGCTTAAGTGATACTATGAAAGCCTTTGCTATTTCTTTATTAACCGATCTATGTATTGGGTTTC
ATCTGCCTCATGGCTGGGAAGTAGTAATAGGTTCTTCTTCAGAACACTTAGGATTTGCTCATAATAAACA
TATAATATCCTGTTTCGTGTCAACTTTTCCGGTTATTTCAGATACAGTTTCTAAATATTGGATTTCTCGT
CATTCGAATCGTATATCTCCTCTAATTGTAGCGACTTATCATACAATGAATGAATAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 25 C -> U 272 U -> C 361 C -> U 752 U -> C 754 U -> C 802 U -> C 895 C -> U 970 U -> C 1300 U -> C 1301 C -> U 1333 C -> U 1334 U -> C 1370 C -> U 1439 C -> U 1466 C -> U 1475 C -> U 1492 C -> U 1493 U -> C
 
 Edited sequence 

AUGAAAUUAUAUCAGUGGCAAAUUUUUCGAUGGUUUUUUGAGACUCUAAAUUGUUCUUUAGGAAGAGCUU AUAAGGCUAGCAAAAGAAUACAGUAUAUAAAGAAAGAUUAUUCAUUCUAUAAAAAUACCAUCUUAUUUUC AAAAGGUUCUUGGCAAGCUAUAAAUCUUUAUACGAAUACAGAAUUGAGAAACACUUUAUUUAUAAUCUAC UGGAGUCUUUUAGAAUAUAGAAUUAGCCUGUGUUUCUUAAAUUUACUAAGGAAAAUUGAAUCUAUUCAAU UUAAAAAAUUAUCCGUUAUUUCUUUUAUUCUUAAUUUACAUUCAUCUCUUUCUCAUGUUAACAAACAGCU UCAAAUUCUAUCAAAAGUUCUUUUUGAUAGAUUUUAUUUUUAUCUUUGGAAAAACAUGUAUUUUUCCCUU CUUCUCCACAAUUCCCUUUCAAGAUUCGUAAAGGAGAGUAUAGAAGAAUCAGAGCAGAGUGGAUUCAACA ACGAAAACAAAAAAGAUUUUCAAGAUGAAACUUAUUUUGUUUUAAAUGAAUCCCUUGAGAAAGAUUUUAG UAGAAUAAGAGAGAUGAAUAGAAAAUUGGCUUGGAUUGAAGUAACUUUAAAUGAUUUAAAUACUUGGAAG AGUUACUACCUCUUCUUCCCAUUUUUAUCAGAGAUGAAGAAUACUCCUCAAAAUGAAUCUUCUUUUAAGU UGAAGAAUUUUGAAAUAACGACUCCAGCUUAUGAUUCUACAGGUUUUAUACCACGUUCCAUAAGUCGUAC UUUAUCUAGAUUUCAAAUAGAAUUGAUGGGUCAGUCAAGUUCAUUGGUACUUCAGGAAUUUCGAUCAGCU AAAUAUCAAGCAUUGGCAUCUAUACAAUAUAUAGGAUGUUUAAUUUUUCUUCCUUGGAUAAUUUCCCGCU CUCUCAAGGAAUGGUUUUUGGAACCCUGGAUUAAAUUUUGGUGGGAUACUUAUCAAUCUCAAAUUUCUCU UAAUUCUUUCCAAGAAGAAAGAGCAUCAGAAGGGCUUCAAGAAGUCGAAGAACCACUUUGGUUGGAUAAA UUGGUGUCAAAUUUUCUGAAAAAUCAAUCCCAAGACCUUAAUAUAGAAAUUUAUGGAGAAACAAUUCAAU UAAUAAGAAUGUACAAUGAAAAUAGUAUUCAAACCAUUUUACAUUUAUUAACAGGUAUGAUUUGCUUCAC UACUUUAGGUGCCUUGUUUAUCUUAGGUAAGAAAAGGCUUUCUGUUUUGAAUUCCUGGAUUCAAGAAUCA UUUUAUAGCUUAAGUGAUACUAUGAAAGCCUUUGCUAUUCUUUUAUUAACCGAUCUAUGUAUUGGGUUUC AUUCGCCUCAUGGCUGGGAAGUAGUAAUAGGUUCUUCUUUAGAACACUUAGGAUUUGCUCAUAAUAAACA UAUAAUAUCCUGUUUCGUGUCAACUUUUCCGGUUAUUUUAGAUACAGUUUCUAAAUAUUGGAUUUUUCGU CAUUUGAAUCGUAUAUCUCCUUCAAUUGUAGCGACUUAUCAUACAAUGAAUGAAUAA