Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   3948
Gene name   rps14
Locus   PhpapaCp041
Organism   Physcomitrella patens
Location Start:End   40431:40733
 
Protein  
MAKKSLIEREKKRQKLEKKYQDFRHSIKKKIKETSSLDEKWEFQKQLQALPRNSAPTRLHRRCFLTGRPR
ANYRDFGLSRHVLREMAHACFLPGVTKSSW
			
    Run BLAST
 
CDS  
ACGGCAAAAAAAAGTCTTATTGAAAGAGAAAAAAAAAGACAAAAATTAGAAAAAAAATATCAAGATTTTC
GTCACTCTATAAAAAAAAAAATTAAGGAAACTTCATCCTTAGATGAAAAATGGGAATTTCAAAAACAATT
ACAAGCTTTACCACGTAATAGCGCACCTACAAGACTTCATCGTCGTTGTTTTTTAACCGGAAGACCTAGA
GCAAATTATCGTGATTTTGGCTTATCTAGGCATGTATTACGAGAAATGGCTCATGCATGTTTTTTACCTG
GAGTAACTAAATCTAGTTGGTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 2 C -> U
 
 Edited sequence 

AUGGCAAAAAAAAGUCUUAUUGAAAGAGAAAAAAAAAGACAAAAAUUAGAAAAAAAAUAUCAAGAUUUUC GUCACUCUAUAAAAAAAAAAAUUAAGGAAACUUCAUCCUUAGAUGAAAAAUGGGAAUUUCAAAAACAAUU ACAAGCUUUACCACGUAAUAGCGCACCUACAAGACUUCAUCGUCGUUGUUUUUUAACCGGAAGACCUAGA GCAAAUUAUCGUGAUUUUGGCUUAUCUAGGCAUGUAUUACGAGAAAUGGCUCAUGCAUGUUUUUUACCUG GAGUAACUAAAUCUAGUUGGUAA

 Other edit remarks: 

Protein sequence is in conflict with the conceptual translation