Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   351
Gene name   rps7
Locus   AnfoCp092
Organism   Anthoceros formosae
Location Start:End   157993:158460
 
Protein  
MSRRGTTEKQIEKPDPIYRNRLVNLLVNRILRNGKKSLAYRILYGAMRNIRRATKKNPLSVLRQAVRRVT
PNVTVKARRVGGSTYQVPIEIESSQGKALAIRWLLVASKKRPGRNMAFKLSYELIDAARDNGNAVRKREE
THRMAEANRAFAHFR
			
    Run BLAST
 
CDS  
ATGTCGCGCCGAGGTACTACAGAGAAACAAATCGAAAAACCTGATCCAATTTATCGTAACTGATTGGTTA
ACTTGTTGGTTAATCGTATCTTGAGGAATGGAAAAAAATCATTGGCTTATCGAATTCTTTATGGAGCCAT
GAGAAATATTAGACGAGCAACGAAGAAAAATCCATTATCCGTATTACGTCAAGCAGTACGTAGAGTAACT
TCTAATGTTACGGTAAAAGCACGACGTGTAGGTGGTTCGACCTATTAAGTCCCCATTGAAATAGAATCTT
CACAAGGAAAAGCGCTTGCTATTCGTTGGTTATTAGTGGCATTTAAAAAACGTCCAGGTCGAAATATGGC
TTTTAAATTGAGTTACGAATCAATAGATGTTGCTAGGGATAATGGAAATGCTGTGCGTAAAAGAGAGGAA
ACTCATAGAATGGCAGAGGCTAATAGAGCTTTCGCTCATTTTCGCTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 61 U -> C 211 U -> C 256 U -> C 323 U -> C 371 C -> U 380 U -> C
 
 Edited sequence 

AUGUCGCGCCGAGGUACUACAGAGAAACAAAUCGAAAAACCUGAUCCAAUUUAUCGUAACCGAUUGGUUA ACUUGUUGGUUAAUCGUAUCUUGAGGAAUGGAAAAAAAUCAUUGGCUUAUCGAAUUCUUUAUGGAGCCAU GAGAAAUAUUAGACGAGCAACGAAGAAAAAUCCAUUAUCCGUAUUACGUCAAGCAGUACGUAGAGUAACU CCUAAUGUUACGGUAAAAGCACGACGUGUAGGUGGUUCGACCUAUCAAGUCCCCAUUGAAAUAGAAUCUU CACAAGGAAAAGCGCUUGCUAUUCGUUGGUUAUUAGUGGCAUCUAAAAAACGUCCAGGUCGAAAUAUGGC UUUUAAAUUGAGUUACGAAUUAAUAGAUGCUGCUAGGGAUAAUGGAAAUGCUGUGCGUAAAAGAGAGGAA ACUCAUAGAAUGGCAGAGGCUAAUAGAGCUUUCGCUCAUUUUCGCUAA