Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   347
Gene name   rps2
Locus   AnfoCp007
Organism   Anthoceros formosae
Location Start:End   14187:14894
 
Protein  
MKQKYWNINLEEMMEAGIHFGHQAAKWNPKMKPYIFTERRGIHILNVTKTARLLSEACDFVANAASKGKQ
FLIVGTKYQAADLVASAALKARCHYVNQKWLGGMLTNWSTIEKRLRKFEDLQTKKNMGALDELPKKEAAN
LERQLAQLQKYLGGIRYMTNLPDIVIIVDQQKELTAIRECINLNIPTICLVDTDCDPDLTDISIPANDDA
RASIRWVLDKLTSAIQEGRCNSTKI
			
    Run BLAST
 
CDS  
ATGAAACAAAAATATTGGAACATTAATTTGGAAGAAATGATGGAAGCAGGAATTCATTTTGGTCATCAAG
CTGCAAAGTGGAATCTTAAAATGAAACCTTATATCTCCACAGAACGTAGGGGCATTCATATCCTAAATGT
TACTAAAACGGCTAGATTCTTATCAGAAGCCTGTGATTTTGTTGCTAATGCTGCGAGTAAAGGGAAGCAG
TTTTTAATAGTAGGTACAAAATATCAAGCAGCTGATTTAGTAGCATCAGCTGCTCTAAAGGCTCGATGTC
ATTATGTAAATCAAAAGTGGCTTGGTGGAATGTCAACAAATTGGTCTACTATAGAAAAACGTTTACGGAA
ATTTGAAGACCCACAAACGAAGAAAAATATGGGAGCGCTTGATGAGCTTCCGAAAAAAGAAGCAGCCAAT
TTGGAAAGACAATTGGCTCAACTGCAAAAATATTTAGGTGGGATTAGGTATATGACAAACTTACTAGATA
TTGTTACAATTGTGGACTAATAAAAAGAATTAACAGCTATTCGGGAATGTATTAATTCAAATATTCCAAC
TATTTGTTTAGTTGATACAGATTGCGATTCAGATCTTACGGATATCTCAATTCCAGCAAATGATGATGCT
AGAGCTTTAACTAGATGGGTTTCGGATAAATCAACTTCAGCTACTTAGGAAGGTCGTTGTAATTCTACGA
AAATCTGA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 15 U -> C 86 U -> C 87 U -> C 107 C -> U 157 U -> C 314 C -> U 362 C -> U 485 U -> C 497 C -> U 508 U -> C 511 U -> C 548 C -> U 589 U -> C 638 U -> C 641 C -> U 653 C -> U 662 C -> U 674 C -> U 676 U -> C
 
 Edited sequence 

AUGAAACAAAAAUACUGGAACAUUAAUUUGGAAGAAAUGAUGGAAGCAGGAAUUCAUUUUGGUCAUCAAG CUGCAAAGUGGAAUCCCAAAAUGAAACCUUAUAUCUUCACAGAACGUAGGGGCAUUCAUAUCCUAAAUGU UACUAAAACGGCUAGACUCUUAUCAGAAGCCUGUGAUUUUGUUGCUAAUGCUGCGAGUAAAGGGAAGCAG UUUUUAAUAGUAGGUACAAAAUAUCAAGCAGCUGAUUUAGUAGCAUCAGCUGCUCUAAAGGCUCGAUGUC AUUAUGUAAAUCAAAAGUGGCUUGGUGGAAUGUUAACAAAUUGGUCUACUAUAGAAAAACGUUUACGGAA AUUUGAAGACCUACAAACGAAGAAAAAUAUGGGAGCGCUUGAUGAGCUUCCGAAAAAAGAAGCAGCCAAU UUGGAAAGACAAUUGGCUCAACUGCAAAAAUAUUUAGGUGGGAUUAGGUAUAUGACAAACUUACCAGAUA UUGUUAUAAUUGUGGACCAACAAAAAGAAUUAACAGCUAUUCGGGAAUGUAUUAAUUUAAAUAUUCCAAC UAUUUGUUUAGUUGAUACAGAUUGCGAUCCAGAUCUUACGGAUAUCUCAAUUCCAGCAAAUGAUGAUGCU AGAGCUUCAAUUAGAUGGGUUUUGGAUAAAUUAACUUCAGCUAUUCAGGAAGGUCGUUGUAAUUCUACGA AAAUCUGA