Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   345
Gene name   rps18
Locus   AnfoCp050
Organism   Anthoceros formosae
Location Start:End   86559:86786
 
Protein  
MNKFKRSSRRRLPPIRSGEIIDYKNTSLLRRFISEQGKILSRRMNKLTSKQQRLVTVAIKRARILALLPF
LNNES
			
    Run BLAST
 
CDS  
ATGAACAAATTTAAACGATCTTCTCGTAGACGGTTGCCACCTATTAGATCTGGAGAAATTATTGATTATA
AGAATACAAGTTTACTCTGAAGATTCATTAGTGAACAAGGAAAAATTTTATCTAGACGAATGAATAAATT
GACTTCGAAACAACAACGTTTAGTAACTGTTGCTATTAAAAGGGCTTGCATTTTAGCGTTGTTACCTTTC
CTCAATAATGAAAGTTGA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 88 U -> C 187 U -> C
 
 Edited sequence 

AUGAACAAAUUUAAACGAUCUUCUCGUAGACGGUUGCCACCUAUUAGAUCUGGAGAAAUUAUUGAUUAUA AGAAUACAAGUUUACUCCGAAGAUUCAUUAGUGAACAAGGAAAAAUUUUAUCUAGACGAAUGAAUAAAUU GACUUCGAAACAACAACGUUUAGUAACUGUUGCUAUUAAAAGGGCUCGCAUUUUAGCGUUGUUACCUUUC CUCAAUAAUGAAAGUUGA