Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   344
Gene name   rps16
Locus   AnfoCp017
Organism   Anthoceros formosae
Location Start:End   26598:26637|27500:27714
 
Protein  
MVKLRLKRYGRKQQNTYRIVAIDAQSRREGRALEEVGFYNLRKDQTQLDILAIVNLIREGAQPTETVYDI
LRKAGIFERIKANP
			
    Run BLAST
 
CDS  
ATGGTAAAACTTCGTCTAAAGCGGTATGGTAGAAAGCAACAAAATACCTATCGAATTGTTGCAATTGATG
CTCAATCTCGGAGAGAAGGACGAGCTCTTGAAGAAGTTGGTTCCTATAATTTGAGAAAAGATCAAACTCA
ATTAGATATTTTAGCTATTGTTAATTCTACTAGAGAAGGGGCTCAACCTACAGAAACTGTTTATGATATT
TCAAGAAAAGCAGGAATATTTGAACGAATTAAGGCTAATCCTTAG
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 73 C -> U 74 C -> U 126 U -> C 127 C -> U 130 C -> U 172 C -> U
 
 Edited sequence 

AUGGUAAAACUUCGUCUAAAGCGGUAUGGUAGAAAGCAACAUGGUAAAACUUCGUCUAAAGCGGUAUGGU AGAAAGCAACAAAAUACCUAUCGAAUUGUUGCAAUUGAUGCUUUAUCUCGGAGAGAAGGACGAGCUCUUG AAGAAGUUGGUUCCUAUAAUUUGAGCUAAUAUCAAACUCAAUUAGAUAUUUUAGCUAUUGUUAAUUCUAC UUGAGAAGGGGCUCAACCUACAGAAACUGUUUAUGAUAUUUCAAG

 Other edit remarks: 

Protein sequence is in conflict with the conceptual translation