Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   340
Gene name   rpoC2
Locus   AnfoCp006
Organism   Anthoceros formosae
Location Start:End   9600:13937
 
Protein  
MAESAKLLFYNKVIDGTAIKQFIGRLVAHFGITYTAHILDQLKTLGFQQATYAATSLGIDDLLTAPSKGW
LIQDAEHHSYTLEKHHRYGNVHAVEKLRQLIETWYATSEYLKQEMNPNFRMTDPLNPVHMMSFSGARGSA
SQVHQLVGMRGLVSDPQGQIIDLPIKSNFREGLSLTEYIISCYGARKGVVDTAVRTSDAGYLTRRLVEVV
QHIVVRKTDCNTFRGISLNSTEDKKKNLQIFTQQKLVGRVLADNLYINARCLAIRNQDINTNLIEKLITL
KTPLISIRSPLTCKSMLWICQLCYGWSLTHYGDLVELGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGD
IAEHVRTPFNGTIEFDTDLVYPTRTRHGHPAWVCRTDLAVTIKSQNKIHNLIIPSQSLLLIQNNQYVESK
QLIAEVHAKVSPFKEKVQKYIYCNIEGEMHWSKRVRHASKYLHSNVHLIFNTGHLWILSGSSHEDKTSSM
FFKNQDQINTKFFISPRKILFMKKTNQVNSKNLDPYLEKEMETLNYSNLYLGILNKSRNFVYPSIILHDY
EVKRIYDEKKGENFLLLEERHGEKKTQIFRRFVLNIPKSGILENKDIFAISNDPGYGIQSPGIIKYGTIK
VNPIKGKGETFKNRETKILRLRPRYQVIEPGNFFPIPEEVHILYESFPPILVRNDSLIKKNTQITSDIRS
QVGGLVRIRRKMNDSYEVKVLPGRVYHPEERRNISKQNDILVPPGEEISNKFQSENWLYLEWITPPKEKP
FIFIRPAIEFIVPEETDLAETFTLNSQKKQEILKVKKIRYLLYEDGEEVEVTNKTGIQLIQTGLVLDWKE
DSSIKKVYASLTEIETNGLSKKFLQISLIEHPIFEIEKKKNNVNLKYLFTNEINYSSHSFNYENGLFNGY
RGIIRISSNENQEDKSLPILSPFDFVQIFLSKNSEEYTPEMKDEGNFNLDTNSIFYAKSFVKKFNQNSIT
SSQNSSGTFINKEFYNHNNINQEFNSRKIIRNFFLSIERNFMEILLLRKLGLLGNSHSLPSPFQFSCWAN
THNQPIINRYSILENLRDVFQVPKWYFFDENKKTHKLDLSKNSIYHLLTWSFSIALSYEEGAIHLVGLGQ
FICENISISSKYQTISESGQIIAIHPEFLVVRLAKPSLATGGATIHSHYGQIIKKGDVLITLVYERLKSG
DIIQGLPKVEQLLEARPINSTSINLENGFENWNRDMTKSLGSLWGFLLSAKTTMNQSQINLVDQIQEVYQ
SQGVYISDKHIEIVVRQMTSKVLTLEDGMANGFLPGELIESSRAQRMNRVLEESVLYKPILLGITKASLN
TQSFISEASFQETTRVLAKAALRGRIDWLKGLKENVIFGGVISAGTGCQEVVWQVILEKRKETYSKRKKN
KLFSGRVRDVFSYYQRILFFPTMKIIHKTLKKPLSEINLDPNYRK
			
    Run BLAST
 
CDS  
GTGGCAGAATCAGCTAAATTGCTATTCTATAATAAAGTAATAGATGGAACTGCCATAAAACAATTTATTG
GCAGATTAGTAGCTCACTTTGGAATTACATATACAGCTCACATTTTGGATCAACCTAAAACTCTGGGTTT
TTAACAAGCTACTTATGCCGCTACTTCATTAGGCATTGACGATCTCTTAACAGCACTGTCAAAGGGATGG
CTCATTCAAGATGCGGAACATCATAGTTATACTTTGGAGAAGCATCATCGCTATGGGAATGTACATGCTG
CGGAAAAATTACGTCAACTCATTGAAACATGGTATGCTACGAGTGAGTATTCAAAATAAGAAATGAATCC
TAATTTCAGAATGACTGATCCCTTAAATCCGGTACATATGATGTCTTTTTCAGGAGCTTGAGGAAGTGCA
TCATAAGTTTATCAATTAGTAGGTATGAGAGGATTAGTGTCAGATTTTTAGGGACAAATTATTGATTTAC
CTATTAAGAGTAATTTCCGCGAGGGATTATCTTTGACCGAATATATTATTTCTTGTTACGGTGCTCGTAA
AGGAGTTGTTGATACTGCCGTGTGAACATTAGATGCTGGATACCTTACATGCAGACTCGTTGAAGTGGTT
CAACATATTGTAGTACGTAAAACAGATTGTAATACTTTTTGAGGTATTTCTTTGAATTCTACCGAAGATA
AGAAGAAAAATTTACAAATATTTACTCAGCAAAAACTAGTGGGTCGTGTACTAGCAGATAATTTATATAT
AAATGCAAGATGTCTTGCTATACGTAATCAAGATATTAATACTAATCTTATTGAAAAATCAATAACTCTT
AAAACACCATTAATTTCAATACGATCTCCCTTGACTTGCAAAAGTATGCTTTGGATTTGTCAATTATGCT
ATGGATGGAGTCTTACTCACTACGGTGATTTAGTAGAATTGGGAGAAGCTGTGGGTATTATAGCAGGCTA
ATTTATCGGGGAACCAGGAACTCAACTAACATTAAGGACTTCCCATACGGGTGGAGTTTCCACAGGTGAC
ATTGCAGAACATGTATGAACCCCTTTTAATGGGACTATTGAATTCGATACAGATTTAGTTTATCCCACAA
GAACACGTCACGGTCACCCCGCTTGGGTATGTCGTACCGATCTAGCTGTTACTATAAAAAGTCAGAATAA
GATACATAATTTGATCATCCCATCTCAAAGTCTACTCTTAATTCAAAACAATCAATATGTAGAATCGAAA
CAACTTATTGCGGAAGTTCATGCTAAGGTATCTTCTTTCAAAGAAAAGGTTCAGAAATACATTTATTGTA
ACATAGAAGGGGAAATGCACTGGAGTAAAAGGGTACGTCATGCTTCTAAATATTTACATAGTAATGTTCA
TTTAATATTTAATACGGGTCACTTATGGATATTATCAGGAAGTTCTCATGAAGATAAAACATCCTCTATG
TTTTTCAAAAATCAGGATCAAATCAATACAAAATTTTTCATTTCTCCACGTAAGATACTTTTTATGAAAA
AGACTAATCAAGTTAATTCAAAAAATCTTGATCCTTATTTAGAAAAAGAAATGGAAACTCTAAATTATTC
GAATCTCTATCTTGGTATACTAAACAAGAGTAGGAACTTCGTATATCCCAGTATTATTTTACATGATTAT
GAGGTAAAGAGAATTTATGATGAAAAAAAAGGCGAAAATTTTCTTTTATTGGAGGAAAGACATGGAGAAA
AAAAAACACAAATTTTTCGTCGATTTGTTCTTAACATACCAAAAAGTGGAATTTTAGAAAATAAGGATAT
TTCTGCCATTTCAAATGATCCTGGATACGGAATTCAAAGCTCAGGAATTATAAAATATGGTACTATAAAA
GTCAATCCAATTAAAGGAAAAGGAGAAACTTTTAAGAATCGAGAAACGAAAATTTTAAGACTTCGACCGA
GATATCAAGTAATTGAACCAGGAAATTTTTTTCTCATTCCTGAAGAAGTGCACATTTCATATGAATCTTT
TCCATCTATCTTAGTACGAAATGATAGTCTTATAAAAAAAAATACACAAATTACTTCGGATATTAGGAGC
CAAGTAGGTGGATTAGTTAGAATAAGAAGAAAGATGAATGATAGTTACGAGGTAAAAGTATTACCTGGTC
GTGTATATCATCCCGAAGAGAGACGAAACATATCTAAACAAAATGACATTTTGGTACCACCGGGAGAAGA
AATTTCTAATAAGTTTCAATCTGAAAATTGGCTTTATCTTGAGTGGATTACACCCCCTAAAGAAAAACCT
TTCATTTTCATTAGACCTGCAATTGAATTTATAGTACCTGAAGAAACAGATTTAGCAGAAACGTTTACTC
CAAATTCACAAAAGAAACAAGAAATTTTGAAAGTAAAAAAGATTCGATATCTTCTCTACGAAGATGGTGA
GGAAGTTGAAGTTACGAATAAAACTGGTATTCAATTAATTTAAACTGGTCTAGTTCTGGATTGGAAAGAA
GATTCTTCTATAAAAAAAGTTTATGCTTCTCTTACTGAAATAGAGACAAATGGATTATCAAAAAAATTTC
TTCAAATTAGCTTGATAGAACACCCTATTTTTGAGATAGAAAAGAAGAAGAATAATGTCAATCTAAAATA
CTTATTCACTAATGAAATTAATTATTCTAGTCACTCTTTCAATTATGAAAATGGATTATTCAATGGGTAT
CGAGGCATCATTCGTATCTCATCTAATGAAAATTAAGAAGATAAATCTCTTCCCATTTTATCCCCTTTTG
ATTTTGTCCAAATTTTCCTATCTAAAAATTCAGAGGAGTATACTCCGGAAATGAAAGATGAAGGAAATTT
CAATTTAGATACCAATTCTATTTTTTACGCCAAATCTTTTGTTAAAAAATTTAATCAAAATTCAATTACT
TCTAGTCAAAATTCTTCTGGTACTTTTATTAATAAAGAATTTTATAATCATAATAATATAAATCAGGAAT
TCAATTCAAGAAAAATAATTAGAAATTTTTTTCTATCAATTGAAAGAAATTTTATGGAAATACTTTTACT
GAGAAAGTTAGGTCTTCTAGGTAATTCACATAGTTTGCCGAGCCCTTTTCAATTCTCTTGTTGGGCAAAT
ACTCATAATCAACCTATCATTAATAGGTATTCAATACTTGAAAATTTAAGAGATGTTTTTCAAGTTCCAA
AATGGTATTTTTTTGATGAGAATAAAAAGACACATAAATTAGATTTATCTAAAAATTCAATCTATCATTT
ATTAACTTGGTCTTTTTCTATCGCCCTTTCATATGAAGAAGGAGCAATTCATTTAGTAGGCCTTGGACAA
TTTATCTGTGAAAATATATCTATATCATCTAAATATCAAACAATCTCTGAATCCGGTCAAATTATAGCTA
TTCATCCGGAATTTCTGGTAGTTAGACTAGCTAAACCCTCTTTAGCCACTGGAGGAGCCACTATTCATAG
TCATTATGGACAAATTATAAAAAAAGGAGATGTTTCAATAACCTTAGTATATGAAAGGTTAAAATCTGGT
GATATTATTCAGGGTCTTCCTAAAGTTGAGTAATTATTAGAAGCTTGTCCAATTAATTCTACTTCAATAA
ATTTAGAAAATGGATTTGAGAATTGGAATAGAGATATGACGAAATCTCTTGGAAGTCTTTGGGGATTCCT
CCTTAGTGCTAAAACAACCATGAACCAAAGTCAAATTAACTTAGTCGATCAAATTCAGGAGGTTCATTAG
TCACAAGGAGTATATATATCAGATAAGCATATAGAAATTGTTGTGCGTCAAATGACATCAAAAGTTCTTA
CTTTAGAAGATGGAATGGCTAATGGTTCTTTACCCGGAGAATTGATTGAATCTTCAAGGGCACAAAGGAT
GAATCGTGTTTCAGAAGAATCAGTTCTTTATAAACCTATATTATTAGGAATAACAAAGGCGTCTCTCAAT
ACTCAGAGTTTTATATCGGAAGCCAGTTCTCAAGAAACTACCCGAGTATTAGCCAAAGCCGCTCTTCGAG
GTCGAATTGACTGGTTAAAAGGGTTAAAAGAAAATGTTATTTTTGGTGGCGTAATCTCCGCCGGTACTGG
ATGTCAAGAAGTAGTGTGGCAAGTAATTTTAGAAAAACGGAAAGAGACTTATTCGAAAAGAAAAAAGAAT
AAACTTTTCAGTGGAAGAGTTCGAGATGTTTTCTCCTATTACCAAAGAATCTTATTTTTTCCTACTATGA
AGATTATTCATAAAACATTGAAGAAACCATTATCGGAAATAAATCTTGACCCTAATTATCGGAAGTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 27 C -> U 125 C -> U 142 U -> C 197 U -> C 281 C -> U 332 C -> U 337 U -> C 409 U -> C 424 U -> C 430 U -> C 466 U -> C 467 U -> C 469 U -> C 583 U -> C 590 U -> C 610 U -> C 670 U -> C 830 C -> U 979 U -> C 983 U -> C 1022 C -> U 1040 C -> U 1066 U -> C 1294 U -> C 1823 C -> U 1839 U -> C 1861 U -> C 1896 U -> C 1994 U -> C 2018 C -> U 2035 U -> C 2058 U -> C 2169 U -> C 2178 U -> C 2381 C -> U 2491 U -> C 2764 U -> C 3536 C -> U 3601 U -> C 3616 U -> C 3775 C -> U 3778 U -> C 3878 C -> U 3932 C -> U 4019 C -> U
 
 Edited sequence 

GUGGCAGAAUCAGCUAAAUUGCUAUUUUAUAAUAAAGUAAUAGAUGGAACUGCCAUAAAACAAUUUAUUG GCAGAUUAGUAGCUCACUUUGGAAUUACAUAUACAGCUCACAUUUUGGAUCAACUUAAAACUCUGGGUUU UCAACAAGCUACUUAUGCCGCUACUUCAUUAGGCAUUGACGAUCUCUUAACAGCACCGUCAAAGGGAUGG CUCAUUCAAGAUGCGGAACAUCAUAGUUAUACUUUGGAGAAGCAUCAUCGCUAUGGGAAUGUACAUGCUG UGGAAAAAUUACGUCAACUCAUUGAAACAUGGUAUGCUACGAGUGAGUAUUUAAAACAAGAAAUGAAUCC UAAUUUCAGAAUGACUGAUCCCUUAAAUCCGGUACAUAUGAUGUCUUUUUCAGGAGCUCGAGGAAGUGCA UCACAAGUUCAUCAAUUAGUAGGUAUGAGAGGAUUAGUGUCAGAUCCUCAGGGACAAAUUAUUGAUUUAC CUAUUAAGAGUAAUUUCCGCGAGGGAUUAUCUUUGACCGAAUAUAUUAUUUCUUGUUACGGUGCUCGUAA AGGAGUUGUUGAUACUGCCGUGCGAACAUCAGAUGCUGGAUACCUUACACGCAGACUCGUUGAAGUGGUU CAACAUAUUGUAGUACGUAAAACAGAUUGUAAUACUUUUCGAGGUAUUUCUUUGAAUUCUACCGAAGAUA AGAAGAAAAAUUUACAAAUAUUUACUCAGCAAAAACUAGUGGGUCGUGUACUAGCAGAUAAUUUAUAUAU AAAUGCAAGAUGUCUUGCUAUACGUAAUCAAGAUAUUAAUACUAAUCUUAUUGAAAAAUUAAUAACUCUU AAAACACCAUUAAUUUCAAUACGAUCUCCCUUGACUUGCAAAAGUAUGCUUUGGAUUUGUCAAUUAUGCU AUGGAUGGAGUCUUACUCACUACGGUGAUUUAGUAGAAUUGGGAGAAGCUGUGGGUAUUAUAGCAGGCCA AUCUAUCGGGGAACCAGGAACUCAACUAACAUUAAGGACUUUCCAUACGGGUGGAGUUUUCACAGGUGAC AUUGCAGAACAUGUACGAACCCCUUUUAAUGGGACUAUUGAAUUCGAUACAGAUUUAGUUUAUCCCACAA GAACACGUCACGGUCACCCCGCUUGGGUAUGUCGUACCGAUCUAGCUGUUACUAUAAAAAGUCAGAAUAA GAUACAUAAUUUGAUCAUCCCAUCUCAAAGUCUACUCUUAAUUCAAAACAAUCAAUAUGUAGAAUCGAAA CAACUUAUUGCGGAAGUUCAUGCUAAGGUAUCUCCUUUCAAAGAAAAGGUUCAGAAAUACAUUUAUUGUA ACAUAGAAGGGGAAAUGCACUGGAGUAAAAGGGUACGUCAUGCUUCUAAAUAUUUACAUAGUAAUGUUCA UUUAAUAUUUAAUACGGGUCACUUAUGGAUAUUAUCAGGAAGUUCUCAUGAAGAUAAAACAUCCUCUAUG UUUUUCAAAAAUCAGGAUCAAAUCAAUACAAAAUUUUUCAUUUCUCCACGUAAGAUACUUUUUAUGAAAA AGACUAAUCAAGUUAAUUCAAAAAAUCUUGAUCCUUAUUUAGAAAAAGAAAUGGAAACUCUAAAUUAUUC GAAUCUCUAUCUUGGUAUACUAAACAAGAGUAGGAACUUCGUAUAUCCCAGUAUUAUUUUACAUGAUUAU GAGGUAAAGAGAAUUUAUGAUGAAAAAAAAGGCGAAAAUUUUCUUUUAUUGGAGGAAAGACAUGGAGAAA AAAAAACACAAAUUUUUCGUCGAUUUGUUCUUAACAUACCAAAAAGUGGAAUUUUAGAAAAUAAGGAUAU UUUUGCCAUUUCAAAUGACCCUGGAUACGGAAUUCAAAGCCCAGGAAUUAUAAAAUAUGGUACUAUAAAA GUCAACCCAAUUAAAGGAAAAGGAGAAACUUUUAAGAAUCGAGAAACGAAAAUUUUAAGACUUCGACCGA GAUAUCAAGUAAUUGAACCAGGAAAUUUUUUUCCCAUUCCUGAAGAAGUGCACAUUUUAUAUGAAUCUUU UCCACCUAUCUUAGUACGAAAUGAUAGCCUUAUAAAAAAAAAUACACAAAUUACUUCGGAUAUUAGGAGC CAAGUAGGUGGAUUAGUUAGAAUAAGAAGAAAGAUGAAUGAUAGUUACGAGGUAAAAGUAUUACCUGGCC GUGUAUACCAUCCCGAAGAGAGACGAAACAUAUCUAAACAAAAUGACAUUUUGGUACCACCGGGAGAAGA AAUUUCUAAUAAGUUUCAAUCUGAAAAUUGGCUUUAUCUUGAGUGGAUUACACCCCCUAAAGAAAAACCU UUCAUUUUCAUUAGACCUGCAAUUGAAUUUAUAGUACCUGAAGAAACAGAUUUAGCAGAAACGUUUACUC UAAAUUCACAAAAGAAACAAGAAAUUUUGAAAGUAAAAAAGAUUCGAUAUCUUCUCUACGAAGAUGGUGA GGAAGUUGAAGUUACGAAUAAAACUGGUAUUCAAUUAAUUCAAACUGGUCUAGUUCUGGAUUGGAAAGAA GAUUCUUCUAUAAAAAAAGUUUAUGCUUCUCUUACUGAAAUAGAGACAAAUGGAUUAUCAAAAAAAUUUC UUCAAAUUAGCUUGAUAGAACACCCUAUUUUUGAGAUAGAAAAGAAGAAGAAUAAUGUCAAUCUAAAAUA CUUAUUCACUAAUGAAAUUAAUUAUUCUAGUCACUCUUUCAAUUAUGAAAAUGGAUUAUUCAAUGGGUAU CGAGGCAUCAUUCGUAUCUCAUCUAAUGAAAAUCAAGAAGAUAAAUCUCUUCCCAUUUUAUCCCCUUUUG AUUUUGUCCAAAUUUUCCUAUCUAAAAAUUCAGAGGAGUAUACUCCGGAAAUGAAAGAUGAAGGAAAUUU CAAUUUAGAUACCAAUUCUAUUUUUUACGCCAAAUCUUUUGUUAAAAAAUUUAAUCAAAAUUCAAUUACU UCUAGUCAAAAUUCUUCUGGUACUUUUAUUAAUAAAGAAUUUUAUAAUCAUAAUAAUAUAAAUCAGGAAU UCAAUUCAAGAAAAAUAAUUAGAAAUUUUUUUCUAUCAAUUGAAAGAAAUUUUAUGGAAAUACUUUUACU GAGAAAGUUAGGUCUUCUAGGUAAUUCACAUAGUUUGCCGAGCCCUUUUCAAUUCUCUUGUUGGGCAAAU ACUCAUAAUCAACCUAUCAUUAAUAGGUAUUCAAUACUUGAAAAUUUAAGAGAUGUUUUUCAAGUUCCAA AAUGGUAUUUUUUUGAUGAGAAUAAAAAGACACAUAAAUUAGAUUUAUCUAAAAAUUCAAUCUAUCAUUU AUUAACUUGGUCUUUUUCUAUCGCCCUUUCAUAUGAAGAAGGAGCAAUUCAUUUAGUAGGCCUUGGACAA UUUAUCUGUGAAAAUAUAUCUAUAUCAUCUAAAUAUCAAACAAUCUCUGAAUCCGGUCAAAUUAUAGCUA UUCAUCCGGAAUUUCUGGUAGUUAGACUAGCUAAACCCUCUUUAGCCACUGGAGGAGCCACUAUUCAUAG UCAUUAUGGACAAAUUAUAAAAAAAGGAGAUGUUUUAAUAACCUUAGUAUAUGAAAGGUUAAAAUCUGGU GAUAUUAUUCAGGGUCUUCCUAAAGUUGAGCAAUUAUUAGAAGCUCGUCCAAUUAAUUCUACUUCAAUAA AUUUAGAAAAUGGAUUUGAGAAUUGGAAUAGAGAUAUGACGAAAUCUCUUGGAAGUCUUUGGGGAUUCCU CCUUAGUGCUAAAACAACCAUGAACCAAAGUCAAAUUAACUUAGUCGAUCAAAUUCAGGAGGUUUAUCAG UCACAAGGAGUAUAUAUAUCAGAUAAGCAUAUAGAAAUUGUUGUGCGUCAAAUGACAUCAAAAGUUCUUA CUUUAGAAGAUGGAAUGGCUAAUGGUUUUUUACCCGGAGAAUUGAUUGAAUCUUCAAGGGCACAAAGGAU GAAUCGUGUUUUAGAAGAAUCAGUUCUUUAUAAACCUAUAUUAUUAGGAAUAACAAAGGCGUCUCUCAAU ACUCAGAGUUUUAUAUCGGAAGCCAGUUUUCAAGAAACUACCCGAGUAUUAGCCAAAGCCGCUCUUCGAG GUCGAAUUGACUGGUUAAAAGGGUUAAAAGAAAAUGUUAUUUUUGGUGGCGUAAUCUCCGCCGGUACUGG AUGUCAAGAAGUAGUGUGGCAAGUAAUUUUAGAAAAACGGAAAGAGACUUAUUCGAAAAGAAAAAAGAAU AAACUUUUCAGUGGAAGAGUUCGAGAUGUUUUCUCCUAUUACCAAAGAAUCUUAUUUUUUCCUACUAUGA AGAUUAUUCAUAAAACAUUGAAGAAACCAUUAUCGGAAAUAAAUCUUGACCCUAAUUAUCGGAAGUAA