Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   339
Gene name   rpoC1
Locus   AnfoCp005
Organism   Anthoceros formosae
Location Start:End   6728:7159|7868:9481
 
Protein  
MIYQEENQHLRIGLASPEEIRGWAERTLPNGEVVGRITEPYTLHYKTHKPEKDGLFCERIFGPIKSGICA
CGKYRSIENQREYSKICEQCGVEFTESRVRRYRMGYIELACPVTHVWYLKRLPSYIANLLAKPLKELESL
VYCDLFLARPIAKKPTLLKLRGLFKYEDQSWKEIFPRFFSPRGFEAFQDREVATGGNAIEKGLASLNLQI
VMDRAYMEWRNLTEQKSTGNEWEDRKIQRRKDLLVRRMELAKNFLQTNMKPEWMVLSLLPVLPPELRPMI
ELGEGELITSDLNELYRRVIYRNNTLLDFLARGRSTPGGLVVCQKRLVQEAVDALIDNGIRGQPMRDSHN
RAYKSFSDLIEGKEGRFRENLLGKRVDYSGRSVIVAGPYLPLHECGLPKEMAVELFQAFVIRGLIGRYLA
PNLRAAKSMIQDKEPIIWKILKEVIQGHPVLLNRAPTLHRLGIQAFEPILVEGRAIRLHPLVCAGFNADF
DGDQMAVHIPLSLEAQVEARLLMFSHTNLLSPVTGNPVSVPSQDMLLGIYVSTIRSNRGIYQNQYHPYDY
RNKNFSYKMFYFHSYDDILKAEKQKQINLHSPLWLRWQVDLHIVTSIDREVPIEIQYESLGTSSQIYENY
QFRKNRKEKILSMYICTTAGRILFNQQIEEAIQGFFEVSQHRSRPLPAIIA
			
    Run BLAST
 
CDS  
ATGATTTACCAAGAGGAGAATCAGCATCTTCGAATTGGATTAGCTTCCCCTGAAGAAATCCGTGGTTGGG
CTGAGAGAACCTTACCTAATGGAGAAGTAGTTGGACGAATAACTGAACCTTATACTTCGCATTATAAAAC
GCATAAACCAGAGAAAGATGGCTTATCTTGTGAAAGAATATTTGGACCTATAAAAAGTGGAATTTGTGCT
TGTGGAAAGTACCGGAGTATTGAAAATCAGAGAGAATATTCAAAAATTCGTGAGCAATGTGGCGTTGAAT
TTACTGAATCTAGAGTTCGTAGATATAGAATGGGATATATAGAATTGGCATGTCCAGTAACTCATGTATG
GTATTTGAAGCGTCTTCTTAGTTATATCGCAAATCTTTTGGCTAAACCTCTAAAAGAATTGGAAAGCCTA
GTATACTGCGATCTTTTTCTCGCTAGGCCAATAGCTAAAAAACCTACTTTATTAAAATTACGAGGTTTAT
TCAAATACGAAGATCAATCTTGGAAGGAAATTTTTCCTCGTTTCTTTTCTCCTCGTGGATTCGAAGCTTT
TCAAGATAGAGAAGTAGCTACTGGAGGAAATGCTATTGAAAAAGGATTAGCTAGTCTGAATTTGCAAATT
GTTATGGATCGTGCATATATGGAATGGAGAAATTTGACGGAACAAAAATCTACCGGAAACGAGTGGGAGG
ATCGTAAGATTTAAAGAAGAAAAGATCTTTTAGTTAGACGCATGGAATTAGCCAAAAACTTTCTCCAAAC
AAATATGAAACCGGAATGGATGGTTTTATCATTATTACTGGTTCTTCTTCCTGAATTAAGACCAATGATT
GAATTAGGAGAAGGTGAATTAATTACTTTCGATTTAAATGAACTTCATAGAAGAGTTATTTATAGAAATA
ATACACTTCTGGATTTTTTAGCCAGAGGTAGATCTACACCAGGAGGTTTGGTTGTTTGCCAAAAAAGATT
GGTTCAAGAAGCTGTGGATGCGCCTATTGATAATGGTATTTGTGGATAACTTATGAGAGATAGTCATAAT
AGAGCTTATAAATTGTTTTCTGATTTAATTGAAGGTAAAGAAGGAAGATTTTGCGAAAATTTACTTGGAA
AATGAGTTGATTATTCAGGTCGTTCCGTTACTGTTGCGGGTCCCTATCCTCCCTTACATGAATGTGGATT
GCTCAAAGAAATGGCAGTAGAGCTTTCTCAAGCTTTTGTAATTCGAGGTTTGATTGGAAGATATCTGGCT
CCAAATCTCCGAGCTGCTAAAAGTATGATTCAAGACAAAGAGTCTATTATATGGAAGATACTTAAAGAAG
TTATACAGGGACATCCGGTACTACTAAATCGAGCACCTATTTTGCATAGATTGGGAATACAAGCATCTGA
ACCTATTCTAGTAGAGGGACGTGCTATTTGTTTACACCCTTCAGTTTGTGCAGGATCTAACGCAGACTTT
GATGGAGATTAAATGGCTGTCCATATACCACTATCTCTGGAAGCCCAAGTAGAGGCTCGTCTATCAATGT
TTTCTCATACAAATCTTTTGTCTCCAGCTACAGGAAATCCCGTTTCTGTACCGAGTCAAGATATGCTTCT
TGGAATTTATGTATCAACTATCAGAAGCAACTGAGGCATTTATCAAAATCAATATCATCCGTATGATTAT
AGAAATAAAAATTTTTCTTATAAAATGTTTTACTTTCATAGTTACGATGATATACTTAAAGCTGAGAAAC
AGAAACAAATAAATTTACATAGTCCTTTATGGCTTCGATGGCAGGTAGATCTACATATAGTCACTTCAAT
TGATAGAGAAGTACCTATTGAAATTCAATATGAATCTCTCGGAACTTCTTCCCAGATTTATGAAAATTAC
CAATTTAGGAAGAATAGAAAAGAAAAAATACTTAGTATGTACATTTGTACAACTGCTGGTCGTATTCCTT
CCAATCAACAAATAGAAGAAGCTATACAAGGTTTTTTTGAAGTTTCTCAACATAGGAGTCGACCACTACC
CGCTATAATAGCGTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 128 C -> U 167 C -> U 259 C -> U 368 U -> C 280 U -> C 377 U -> C 386 U -> C 437 U -> C 454 C -> U 572 C -> U 589 U -> C 595 U -> C 599 U -> C 632 U -> C 670 U -> C 691 U -> C 719 C -> U 737 C -> U 761 U -> C 785 C -> U 871 U -> C 938 U -> C 965 C -> U 997 U -> C 1010 C -> U 1025 C -> U 1048 U -> C 1103 C -> U 1136 C -> U 1210 U -> C 1526 C -> U 1529 C -> U
 
 Edited sequence 

AUGAUUUACCAAGAGGAGAAUCAGCAUCUUCGAAUUGGAUUAGCUUCCCCUGAAGAAAUCCGUGGUUGGG CUGAGAGAACCUUACCUAAUGGAGAAGUAGUUGGACGAAUAACUGAACCUUAUACUUUGCAUUAUAAAAC GCAUAAACCAGAGAAAGAUGGCUUAUUUUGUGAAAGAAUAUUUGGACCUAUAAAAAGUGGAAUUUGUGCU UGUGGAAAGUACCGGAGUAUUGAAAAUCAGAGAGAAUAUUCAAAAAUUUGUGAGCAAUGUGGCGUUGAAU UUACUGAAUCUAGAGUUCGUAGAUAUAGAAUGGGAUAUAUAGAAUUGGCAUGUCCAGUAACUCAUGUAUG GUAUUUGAAGCGUCUUCCUAGUUAUAUCGCAAAUCUUUUGGCUAAACCUCUAAAAGAAUUGGAAAGCCUA GUAUACUGCGAUAUGAUUUACCAAGAGGAGAAUCAGCAUCUUCGAAUUGGAUUAGCUUCCCCUGAAGAAA UCCGUGGUUGGGCUGAGAGAACCUUACCUAAUGGAGAAGUAGUUGGACGAAUAACUGAACCUUAUACUUC GCAUUAUAAAACGCAUAAACCAGAGAAAGAUGGCUUAUCUUGUGAAAGAAUAUUUGGACCUAUAAAAAGU GGAAUUUGUGCUUGUGGAAAGUACCGGAGUAUUGAAAAUCAGAGAGAAUAUUCAAAAAUUCGUGAGCAAU GUGGCGUUGAACUUACUGAAUCUAGAGUUCGUAGAUAUAGAAUGGGAUAUAUAGAAUUGGCAUGUCCAGU AACUCAUGUAUGGUAUUUGAAGCGUCUUCUUAGUUAUACCGCAAAUCCUUUGGCUAAACCUCUAAAAGAA UUGGAAAGCCUAGUAUACUGCGAUCUUUCUCUCGCUAGGCCAAUAUCUAAAAAACCUACUUUAUUAAAAU UACGAGGUUUAUUCAAAUACGAAGAUCAAUCUUGGAAGGAAAUUUUUCCUCGUUUCUUUUCUCCUCGUGG AUUCGAAGCUUUUCAAGAUAGAGUAGUAGCUACUGGAGGACAUGCUCUUGCAAAAGGAUUAGCUAGUCUG AAUUUGCAAAUUGCUAUGGAUCGUGCAUAUAUGGAAUGGAGAAAUUUGACGCAACAAAAAUCUACCGGAA ACCAGUGGGAGGAUCGUAAGAUUUAAAGAAUAAAAGAUCUUUUAGUUAUACGCAUGGAAUUAGCCAAAAA CUCUCUCCAAACAAAUAUGAAACCGGUAUGGAUGGUUUUAUCAUUAUUACUGGUUCUUCUUCCUGAAUUA AGACCAAUGAUUGAAUUAGGAGAAGGUGAAUUAAUUACUUUCCAUUUAAAUGAACUUCAUAGAAGAGUUA UUUAUAGAAAUAAUACACUUCUGGAUUUUUUAGCCAGAGCUAGAUCUACACCAGGAGGUUUGGUUGUUUG CCAAAAAAGAUUGGUUCAAGAAGCUGUGCAUGCGCCUAUUGUUAAUGGUAUUUGUGUAUAACUUAUGAGA GAUAGUCAUCAUAGAGCUUAUAAAUUGUUUUCUGAUUUAAUUGAAGGUAAAGAAGGAAGAUUUUUCGAAA AUUUACUUGGAAAAUGAGUUGAUUAUUUAGGUCGUUCCGUUACUGUUGCGGGUCCCUAUCCUCCCUUACA UGAAUGUGGAUUGCUCAAAGAAAUGGCAGUACAGCUUUCUCAAGCUUUUGUAAUUCGAGGUUUGAUUGGA AGAUAUCUGGCUCCAAAUCUCCGAGCUGCUAAAAGUAUGAUUCAAGACAAAGAGUCUAUUAUAUGGAAGA UACUUAAAGAAGUUAUACAGGGACAUCCGGUACUACUAAAUCGAGCACCUAUUUUGCAUAGAUUGGGAAU ACAAGCAUCUGAACCUAUUCUAGUAGAGGGACGUGCUAUUUGUUUACACCCUUCAGUUUGUGCAGGAUCU AACGCAGACUUUGAUGGAGAUUAAAUGGCUGUCCAUAUACCACUAUCUCUGGAAGCCCAAGUAGAGGUUC UUCUAUCAAUGUUUUCUCAUACAAAUCUUUUGUCUCCAGCUACAGGAAAUCCCGUUUCUGUACCGAGUCA AGAUAUGCUUCUUGGA