Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   338
Gene name   rpoB
Locus   AnfoCp004
Organism   Anthoceros formosae
Location Start:End   3486:6701
 
Protein  
MILRKKIELFVLPEFTEIQFEGFHRFIKYGLVKELNDFPKIEDTDQEFEFQLFSRQYQLAEPPIEERDAI
YQSITYSSDLYVPAQLTERKKGRVKKQIVFLGSIPLMNSQGTFVVNGVARVIINQILRSPGIYYNSELDR
NGIPIYTGTIISDWGRRLKLEIDGKTRIWARISKKRKVSILVLLLAMGLDIEEILGNVCYPKLLLGCMKR
KTKKEHLQSTEDAIVELYKQIYCIGGDLNFSESISKELQKKFFQQRCELGKIGRLNLNKKLNLDVPENEN
FLLPQDLLAAVDYLIKIRFGIGVPDDIDHLKNRRVRSVTDLLQDQLKLALNRLENSIRQAIRGANRREHL
PTPKSLVTSTPLITTFKEFFGSHPLSQFLDQTNPLTEVVHKRRLSSLGPGGLTRRTASFQVRDIHPSHYG
RICPIETSEGMNAGLVASLAIHAKVDNWGSLESPFYKISGVSEEEDMTFLSAGEDENYHIATGNCLALNQ
TNQEEQVTPARYRQEFVATAWNQINLRSIFPLQYFSIGTSLIPFLEHNDANRALMGFNMQRQAVPLSKPE
KCIVGTGLESQTALDSGSVIVATEGGRISYTDGRRITLLTKEKEVETKLVIYQRSNNSTCIHEKPRIQLR
EYVKKGQILADGRATAGGELALGKNILVAYMPWEGYNFEDAILISERLIHEDIYTSIHIERYEIEARVTS
QGPERITREIPHLDNYLLRHLDESGLVLPGSWVETGDVLVGKLTPQETEESLRAPEGKLLQAIFGIQVVT
AKETCLKVPLGGRGRVIDIKWIYQEKTSTTYAEIVHVYILQKREIQVGDKVAGRHGNKGIISKILPRQDM
PYLQDGTPVDMVLSPLGVPSRMNVGQIFECLLGLAGDFLQKHYRVTPFDERYEREASRKLVFSELHEASR
QTANPWLFESDNPGKSGLLDGRTGDIFEEPVTIGKAYMLKLIHQVDDKIHARSSGPYALVTQQPLRGKSR
RGGQRVGEMEVWALEGFGAAYTLEEMLTIKSDHIQARFEVLRAIVTGELIPKPETAPESFRLLVRELRSL
ALNLDHIIVSEKELRIKFKDI
			
    Run BLAST
 
CDS  
ATGATTTTAAGGAAAAAAATAGAGTTGTTTGTATTACCTGAATTTACAGAGATACAATTCGAAGGATTTC
ATCGCTTTATTAAGTATGGGTTAGTTAAAGAACTCAACGATTTCCCTAAAATTGAAGATACAGATTAGGA
ATTTGAATTTCAACTTTTTAGTAGGCAGTATCAACTGGCAGAACCTCCTATTGAGGAGAGAGATGCTATA
TATCAATCTATAACATATTCATCTGATTCATATGTGCCGGCTCAACTAACTGAAAGAAAAAAAGGAAGAG
TAAAAAAACAAATTGTATTTCTTGGAAGTATTCCCCTAATGAATTCCCAGGGTACTTTTGTTGTTAATGG
AGTTGCTAGAGTAATTATAAATCAAATTCTACGAAGTCCCGGCATTTATTATAATTCAGAATTAGATCGC
AACGGAATTCCTATATATACTGGCACTACTATTCCAGATTGGGGAAGAAGGTTGAAACTAGAAATTGATG
GAAAAACAAGAATCTGGGCTCGTATAAGCAAAAAAAGAAAAGTATCTATTCTAGTTTTATTATTAGCTAT
GGGTTTGGACATTGAAGAAATCCTAGGCAATGTCTGTTATCCCAAATTACTCTTAGGTTGTATGAAAAGG
AAGACGAAGAAAGAGCATCTTCAGTCAACGGAAGATGCCATAGTAGAACTTTATAAACAAATATATTGTA
TAGGCGGAGATTTAAATTTTTCTGAGTCTATAAGTAAGGAGTTGCAAAAAAAATTTTTTCAGCAGAGATG
TGAACCAGGAAAAATAGGTCGATTAAACTTAAATAAGAAACTTAATCTTGATGTACCTGAAAACGAAAAT
TTTTTATTACCACAAGATCTATTAGCTGCCGTAGATTATTCAATAAAAATTAGATTTGGCATAGGTGTAC
CTGACGATATTGATCACTTAAAAAATCGCCGTGTTCGTTCTGTAACTGACCTATTGCAAGATCAATCAAA
ATTAGCTTTGAATCGTTTAGAGAATTCGATACGGCAAGCCATACGTGGAGCAAATAGACGTGAACATTTA
CCAACTCCCAAAAGCCTAGTAACGTCAACTCCATTAATAACAACTTTTAAAGAATTCTTTGGTTCGCATC
CTTTGTCACAATTCCTAGATCAAACTAATCCATTGACAGAAGTGGTTCATAAATGGAGACTAAGTTCCTC
AGGGCCAGGAGGATTAACAAGACGAACTGCAAGTTTTCAAGTACGAGATACTCATCCTAGTTATTATGGG
TGAATTCGTCCCATTGAAACATCTGAAGGAATGAATGCCGGACTTGTTGCATCACTAGCCATTCATGCCA
AAGTTGATAATTGGGGATCTTTGGAGAGTCCATTCTATAAAATATCTGGAGTATCTGAAGAAGAAGATAT
GACTTTTTTATCAGCAGGAGAAGATGAAAACTATCACATAGCAACGGGAAATTGTTTAGCCTTGAATCAA
ACAAATCAAGAGGAACAAGTAACTCCAGCTCGATATCGACAAGAATTTGTCGCCACTGCATGGAATCAAA
TAAACCTTCGAAGTATTTTTCCTTCACAATATTTTTCTATTGGAACTTCCTCGATTCCTCTTCTTGAACA
TAATGATGCAAATTGTGCTTTAATGGGTTTTAATATGCAGTGTCAAGCTGTTCCACTTTCCAAACCTGAG
AAGTGCATTGTAGGGACAGGATTGGAAAGCCAAACAGCTCCAGATTCAGGAAGTGTAATTGTAGCCACAG
AAGGAGGAAGAATTAGTTATACCGATGGTAGAAGAATTACATTATTGACGAAGGAGAAAGAGGTAGAAAC
AAAATTGGTAATATATCAACGTTCCAATAATAGTACTTGTATACATGAGAAACCCCGAATTCAGTTGAGA
GAATACGTAAAAAAGGGACAAATTCTAGCGGATGGGAGAGCTACTGCAGGAGGAGAATCAGCTTCAGGAA
AAAATATATTAGTAGCTTATATGCCATGGGAGGGATATAATTCTGAAGATGCTATACTTATTAGTGAACG
TCTGATACATGAAGATATTTATACTTCTATTCATATTGAGAGGTATGAAATTGAAGCTCGCGTAACAAGT
CAGGGTCCCGAAAGAATTACTAGAGAAATACCTCATTTAGATAATTATTTACTTTGTCATTCAGATGAAA
GTGGTCTTGTATTACCAGGATTTTGGGTAGAAACAGGAGATGCTTCGGTTGGTAAATTGACACCTCAGGA
AACAGAAGAATCACTACGTGCTCCAGAAGGTAAATCATTACAAGCTATATTTGGGATTCAAGTAGTTACA
GCAAAAGAGACTTGTCTTAAAGTACCTTTAGGCGGAAGAGGCCGAGTCATCGATATAAAATGGATCTATC
AGGAAAAAACTTCGACAACTTATGCAGAAATTGTCCATGTATATATCCTGCAAAAGCGCGAAATACAAGT
AGGTGATAAAGTAGCTGGAAGACATGGAAATAAGGGTATTATTCCGAAAATATTGCCTAGACAGGATATG
CCTCATTTACAAGATGGAACACCTGTTGATATGGTTCTAAGTCCCTTAGGTGTACCTTTAAGGATGAATG
TGGGACAAATATTTGAATGTTTACTTGGTTTAGCAGGGGACTTCCCGCAAAAGCATTATAGAGTAACACC
TTTCGATGAAAGATATGAGAGGGAAGCTTTAAGAAAGCTAGTTTCTTCTGAATTGCATGAGGCTAGTAGA
CAAACTGCTAATCCATGGTTATTTGAATCTGATAATCCTGGAAAAAGCGGATTACTTGATGGAAGAACGG
GAGACATTTTTGAAGAACCTGTCACTATAGGAAAGGCTTATATGTTGAAATTGATCCATCAAGTTGATGA
TAAAATTCATGCATGCTCTAGTGGACCTTATGCACCTGTGACGCAATAACCTCTTAGAGGAAAATCTCGG
CGGGGGGGATAACGAGTAGGAGAAATGGAAGTTTGGGCTTTGGAAGGTTTCGGTGCCGCTTATACCTTAG
AAGAAATGCCTACTATAAAGTCTGATCATATTCAGGCCCGTTTTGAGGTACTTAGGGTCATTGTAACTGG
AGAATTGATACCCAAACCTGAAACAGCTCCAGAATCTTTTCGATTATTGGTTCGAGAATTGTGATCTCTA
GCTCCAAATTTAGATCATATTATTGTATCTGAAAAAGAATTAAGAATAAAATTTAAAGACATTTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 136 U -> C 239 C -> U 449 C -> U 454 C -> U 776 C -> U 881 C -> U 977 C -> U 1174 U -> C 1190 C -> U 1241 C -> U 1252 U -> C 1261 U -> C 1267 C -> U 1565 C -> U 1592 C -> U 1600 C -> U 1624 U -> C 1651 U -> C 1721 C -> U 1949 C -> U 1955 C -> U 2003 C -> U 2155 U -> C 2162 C -> U 2192 U -> C 2213 C -> U 2216 C -> U 2276 C -> U 2494 C -> U 2524 C -> U 2579 U -> C 2636 C -> U 2690 U -> C 2705 C -> U 2884 U -> C 2906 C -> U 2917 U -> C 2950 U -> C 3020 C -> U 3068 U -> C 3142 U -> C 3155 C -> U
 
 Edited sequence 

AUGAUUUUAAGGAAAAAAAUAGAGUUGUUUGUAUUACCUGAAUUUACAGAGAUACAAUUCGAAGGAUUUC AUCGCUUUAUUAAGUAUGGGUUAGUUAAAGAACUCAACGAUUUCCCUAAAAUUGAAGAUACAGAUCAGGA AUUUGAAUUUCAACUUUUUAGUAGGCAGUAUCAACUGGCAGAACCUCCUAUUGAGGAGAGAGAUGCUAUA UAUCAAUCUAUAACAUAUUCAUCUGAUUUAUAUGUGCCGGCUCAACUAACUGAAAGAAAAAAAGGAAGAG UAAAAAAACAAAUUGUAUUUCUUGGAAGUAUUCCCCUAAUGAAUUCCCAGGGUACUUUUGUUGUUAAUGG AGUUGCUAGAGUAAUUAUAAAUCAAAUUCUACGAAGUCCCGGCAUUUAUUAUAAUUCAGAAUUAGAUCGC AACGGAAUUCCUAUAUAUACUGGCACUAUUAUUUCAGAUUGGGGAAGAAGGUUGAAACUAGAAAUUGAUG GAAAAACAAGAAUCUGGGCUCGUAUAAGCAAAAAAAGAAAAGUAUCUAUUCUAGUUUUAUUAUUAGCUAU GGGUUUGGACAUUGAAGAAAUCCUAGGCAAUGUCUGUUAUCCCAAAUUACUCUUAGGUUGUAUGAAAAGG AAGACGAAGAAAGAGCAUCUUCAGUCAACGGAAGAUGCCAUAGUAGAACUUUAUAAACAAAUAUAUUGUA UAGGCGGAGAUUUAAAUUUUUCUGAGUCUAUAAGUAAGGAGUUGCAAAAAAAAUUUUUUCAGCAGAGAUG UGAACUAGGAAAAAUAGGUCGAUUAAACUUAAAUAAGAAACUUAAUCUUGAUGUACCUGAAAACGAAAAU UUUUUAUUACCACAAGAUCUAUUAGCUGCCGUAGAUUAUUUAAUAAAAAUUAGAUUUGGCAUAGGUGUAC CUGACGAUAUUGAUCACUUAAAAAAUCGCCGUGUUCGUUCUGUAACUGACCUAUUGCAAGAUCAAUUAAA AUUAGCUUUGAAUCGUUUAGAGAAUUCGAUACGGCAAGCCAUACGUGGAGCAAAUAGACGUGAACAUUUA CCAACUCCCAAAAGCCUAGUAACGUCAACUCCAUUAAUAACAACUUUUAAAGAAUUCUUUGGUUCGCAUC CUUUGUCACAAUUCCUAGAUCAAACUAAUCCAUUGACAGAAGUGGUUCAUAAACGGAGACUAAGUUCCUU AGGGCCAGGAGGAUUAACAAGACGAACUGCAAGUUUUCAAGUACGAGAUAUUCAUCCUAGUCAUUAUGGG CGAAUUUGUCCCAUUGAAACAUCUGAAGGAAUGAAUGCCGGACUUGUUGCAUCACUAGCCAUUCAUGCCA AAGUUGAUAAUUGGGGAUCUUUGGAGAGUCCAUUCUAUAAAAUAUCUGGAGUAUCUGAAGAAGAAGAUAU GACUUUUUUAUCAGCAGGAGAAGAUGAAAACUAUCACAUAGCAACGGGAAAUUGUUUAGCCUUGAAUCAA ACAAAUCAAGAGGAACAAGUAACUCCAGCUCGAUAUCGACAAGAAUUUGUCGCCACUGCAUGGAAUCAAA UAAACCUUCGAAGUAUUUUUCCUUUACAAUAUUUUUCUAUUGGAACUUCCUUGAUUCCUUUUCUUGAACA UAAUGAUGCAAAUCGUGCUUUAAUGGGUUUUAAUAUGCAGCGUCAAGCUGUUCCACUUUCCAAACCUGAG AAGUGCAUUGUAGGGACAGGAUUGGAAAGCCAAACAGCUCUAGAUUCAGGAAGUGUAAUUGUAGCCACAG AAGGAGGAAGAAUUAGUUAUACCGAUGGUAGAAGAAUUACAUUAUUGACGAAGGAGAAAGAGGUAGAAAC AAAAUUGGUAAUAUAUCAACGUUCCAAUAAUAGUACUUGUAUACAUGAGAAACCCCGAAUUCAGUUGAGA GAAUACGUAAAAAAGGGACAAAUUCUAGCGGAUGGGAGAGCUACUGCAGGAGGAGAAUUAGCUUUAGGAA AAAAUAUAUUAGUAGCUUAUAUGCCAUGGGAGGGAUAUAAUUUUGAAGAUGCUAUACUUAUUAGUGAACG UCUGAUACAUGAAGAUAUUUAUACUUCUAUUCAUAUUGAGAGGUAUGAAAUUGAAGCUCGCGUAACAAGU CAGGGUCCCGAAAGAAUUACUAGAGAAAUACCUCAUUUAGAUAAUUAUUUACUUCGUCAUUUAGAUGAAA GUGGUCUUGUAUUACCAGGAUCUUGGGUAGAAACAGGAGAUGUUUUGGUUGGUAAAUUGACACCUCAGGA AACAGAAGAAUCACUACGUGCUCCAGAAGGUAAAUUAUUACAAGCUAUAUUUGGGAUUCAAGUAGUUACA GCAAAAGAGACUUGUCUUAAAGUACCUUUAGGCGGAAGAGGCCGAGUCAUCGAUAUAAAAUGGAUCUAUC AGGAAAAAACUUCGACAACUUAUGCAGAAAUUGUCCAUGUAUAUAUCCUGCAAAAGCGCGAAAUACAAGU AGGUGAUAAAGUAGCUGGAAGACAUGGAAAUAAGGGUAUUAUUUCGAAAAUAUUGCCUAGACAGGAUAUG CCUUAUUUACAAGAUGGAACACCUGUUGAUAUGGUUCUAAGUCCCUUAGGUGUACCUUCAAGGAUGAAUG UGGGACAAAUAUUUGAAUGUUUACUUGGUUUAGCAGGGGACUUCCUGCAAAAGCAUUAUAGAGUAACACC UUUCGAUGAAAGAUAUGAGAGGGAAGCUUCAAGAAAGCUAGUUUUUUCUGAAUUGCAUGAGGCUAGUAGA CAAACUGCUAAUCCAUGGUUAUUUGAAUCUGAUAAUCCUGGAAAAAGCGGAUUACUUGAUGGAAGAACGG GAGACAUUUUUGAAGAACCUGUCACUAUAGGAAAGGCUUAUAUGUUGAAAUUGAUCCAUCAAGUUGAUGA UAAAAUUCAUGCACGCUCUAGUGGACCUUAUGCACUUGUGACGCAACAACCUCUUAGAGGAAAAUCUCGG CGGGGGGGACAACGAGUAGGAGAAAUGGAAGUUUGGGCUUUGGAAGGUUUCGGUGCCGCUUAUACCUUAG AAGAAAUGCUUACUAUAAAGUCUGAUCAUAUUCAGGCCCGUUUUGAGGUACUUAGGGCCAUUGUAACUGG AGAAUUGAUACCCAAACCUGAAACAGCUCCAGAAUCUUUUCGAUUAUUGGUUCGAGAAUUGCGAUCUCUA GCUCUAAAUUUAGAUCAUAUUAUUGUAUCUGAAAAAGAAUUAAGAAUAAAAUUUAAAGACAUUUAA