Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   335
Gene name   rpl33
Locus   AnfoCp049
Organism   Anthoceros formosae
Location Start:End   86330:86527
 
Protein  
MAKSKDIRIAITLECTSCSENDEKRFSGVSRYVSEKNRRNTPTRLELKKFCPYCYKHKIHREIKK
			
    Run BLAST
 
CDS  
ATGGCTAAGAGTAAAGATATAAGAATAGCAATTACTTTAGAATGTACTAGTTGCTCCGAAAATGACGAAA
AAAGATTCTCAGGTGTTTCTAGATATGTAAGTGAAAAGAATCGTCGTAATACACCTACTTGATTAGAATT
AAAGAAGTTTTGTCCCTATTGCTATAAGCACAAGATTCACAGAGAAATAAAAAAATAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 130 U -> C
 
 Edited sequence 

AUGGCUAAGAGUAAAGAUAUAAGAAUAGCAAUUACUUUAGAAUGUACUAGUUGCUCCGAAAAUGACGAAA AAAGAUUCUCAGGUGUUUCUAGAUAUGUAAGUGAAAAGAAUCGUCGUAAUACACCUACUCGAUUAGAAUU AAAGAAGUUUUGUCCCUAUUGCUAUAAGCACAAGAUUCACAGAGAAAUAAAAAAAUAA