Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   334
Gene name   rpl32
Locus   AnfoCp077
Organism   Anthoceros formosae
Location Start:End   126400:126609
 
Protein  
MAVPKKRTSKSKRKIRKTVWREKANKAAKKAFSLARLILSGRSKSFCYTVNNKSSESSESTSIDESDDS
			
    Run BLAST
 
CDS  
ATGGCAGTTCCGAAGAAGCGTACTTCTAAATCAAAAAGAAAGATTCGTAAAACTGTGTGGAGAGAAAAGG
CTAATAAGGCCGCAAAAAAAGCTTTCTCCCTAGCACGTTTAATTTTAAGTGGTCGTTCAAAGAGTTTTTG
TTACACAGTAAATAATAAGTCTTCCGAATTCTCTGAATCTACATCTATTGATGAATCAGATGATTCATGA

			
    Run BLAST
 
mRNA Edited   Edits at following locations: 100 C -> U 170 U -> C
 
 Edited sequence 

AUGGCAGUUCCGAAGAAGCGUACUUCUAAAUCAAAAAGAAAGAUUCGUAAAACUGUGUGGAGAGAAAAGG CUAAUAAGGCCGCAAAAAAAGCUUUCUCCUUAGCACGUUUAAUUUUAAGUGGUCGUUCAAAGAGUUUUUG UUACACAGUAAAUAAUAAGUCUUCCGAAUCCUCUGAAUCUACAUCUAUUGAUGAAUCAGAUGAUUCAUGA

 Other edit remarks: 

Protein sequence is in conflict with the conceptual translation