Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   331
Gene name   rpl21
Locus   AnfoCp076
Organism   Anthoceros formosae
Location Start:End   125882:126238
 
Protein  
MNTYAIIDTGGEQLRVEPGRFYDMRHFTLLNPSILDSNTKVLIYRVLMIHHESNIALGDSWLEDATIKGR
VLHSHFKDKITIYKMRSKKKMRRKLGYRLNLARFVVDSICFDGKEFYK
			
    Run BLAST
 
CDS  
ATGAATACATATGCAATAATTGATACCGGAGGTGAGCAACTCTGAGTTGAACCAGGAAGATTTTATGATA
TGCGTCACTTTACTTTACTAAATCCGAGTATTTTAGATTCAAATACTAAAGTATTAATCTATCGAGTATT
AATGATTCATCATGAATTGAATATCGCTCTTGGAGATCTCCGGTTAGAAGATGCAACAATTAAAGGAAGA
GTTTTACATTCTCACTTTAAAGACAAAATTACAATTTACAAAATGCGTTCTAAGAAAAAGATGTGACGTA
AATTAGGATATCGATTAAATTTAGCCTGATCTGTGGTGGATCCCACTTGTTTCGATGGAAAAGAATTCTA
CAAATAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 43 U -> C 158 U -> C 178 C -> U 179 U -> C 181 C -> U 274 U -> C 307 U -> C 311 C -> U 322 C -> U 326 C -> U
 
 Edited sequence 

AUGAAUACAUAUGCAAUAAUUGAUACCGGAGGUGAGCAACUCCGAGUUGAACCAGGAAGAUUUUAUGAUA UGCGUCACUUUACUUUACUAAAUCCGAGUAUUUUAGAUUCAAAUACUAAAGUAUUAAUCUAUCGAGUAUU AAUGAUUCAUCAUGAAUCGAAUAUCGCUCUUGGAGAUUCCUGGUUAGAAGAUGCAACAAUUAAAGGAAGA GUUUUACAUUCUCACUUUAAAGACAAAAUUACAAUUUACAAAAUGCGUUCUAAGAAAAAGAUGCGACGUA AAUUAGGAUAUCGAUUAAAUUUAGCCCGAUUUGUGGUGGAUUCCAUUUGUUUCGAUGGAAAAGAAUUCUA CAAAUAA