Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   326
Gene name   rbcL
Locus   AnfoCp036
Organism   Anthoceros formosae
Location Start:End   72912:74339
 
Protein  
MSPQTETKAGVGFKAGVKDYRLTYYTPDYETKDTDILAAFRMTPQPGVPPEEAGAAVAAESSTGTWTTVW
TDGLTSLDRYKGRCYDIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRI
PPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQP
FMRWRDRFLFVAEAIFKSQAETGEIKGHYLNATAGTCEEMMKRAHFARELGMPIVMHDYLTGGFTANTTL
ARYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGEREVTLGFVDLLR
DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMSALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNDIIREASKWSPELAAACEVWKEIKFVFETIDTL
			
    Run BLAST
 
CDS  
ATGTCACCACAAACGGAGACTAAAGCAGGTGTTGGATTTAAAGCTGGTGTTAAAGATTATAGATTAACCC
ATTATACCCCTGATTACGAGACCAAGGATACTGATATTTTGGCAGCGTCTTGAATGACTCCTTAACCAGG
GGTGCCACCTGAAGAAGCAGGAGCCGCAGTAGCTGCTGAATCTTCAACTGGTACATGGACTACTGTTTGG
ACCGATGGACTTACCAGCCTTGACCGTTACAAAGGTCGATGCTACGACATTGAACCTGTTGCTGGAGAGG
AAAATCAATATATTGCTTATGCTGCTTATTCTTTAGATTTGTTTGAGGAGGGTTCTGTTACCAACATGTT
CACTTCCATTGTAGGTAATGTTTTTGGATTTAAAGCTTTACGAGCTTCACGTCTAGAAGATTCACGAATT
CCACCTGCTTATTCCAAAACCTTTCAAGGTCCACCTCATGGTATTCAAGTTGAAAGAGATAAATCGAATA
AATATGGTCGTCCTTTATTAGGATGTACCATTAAACCAAAGTTAGGTTTATCTGCCAAAAACTATGGTAG
AGCTGTATATGAATGTCTTCGTGGTGGACTTGATTTCACCAAAGATGACGAAAATGTTAATTCTCAACCT
TTTATGCGTTGGAGAGATCGTTTTCTATTCGTAGCAGAAGCTATTTCTAAATCTCAAGCTGAAACAGGGG
AGATTAAAGGGCATTACTTAAATGCCACTGCAGGTACATGTGAGGAAATGATGAAAAGGGCACATTTTGC
TAGAGAATTAGGAATGCCTATCGTAATGCATGATTATTTGACAGGAGGTTTTATTGCAAATACGACCCTG
GCTCGTTATTGTAGAGACAATGGTTTACTTCTTCATATTCATCGTGCCATGCATGCAGTTACCGACAGAC
AAAGAAATCATGGTATTCACTTTCGTGTATCAGCTAAAGCATCACGTATGTCCGGGGGAGATCATATTCA
TCCAGGTACAGTAGTAGGTAAATTAGAGGGAGAATGTGAAGTAACTTTAGGTTTTGTGGATTTACCTTGT
GACGATTATATTGAAAAAGATAGAAGTCGTGGGATATATTTTACTCAAGACTGGGTCTCTATGCCTGGTG
TTTTGCTCGTGGCTTCAGGTGGTATTCATGTTTGGCATATGTCAGCTTTAACTGAGATTTTCGGAGATGA
TTCCGTACTACAGTTTGGCGGGGGAACTCTAGGACACCCTTGGGGAAATGCACCTGGTGCAGTAGCTAAT
CGAGTTGCTTTAGAAGCTTGTGTGCAAGCTCGTAATGAAGGACGTGATCTTGCTCGCGAGGGTAATGATA
TTATCCGTGAAGCTAGTAAATGGAGTCCTGAATTAGCAGCTGCTTGTGAAGTATGGAAAGAAATTAAATT
CGTTTTTGAGACGATTGATACTCTATAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 70 C -> U 119 C -> U 121 U -> C 133 U -> C 302 C -> U 310 U -> C 398 C -> U 413 C -> U 485 C -> U 677 C -> U 824 U -> C 902 C -> U 903 C -> U 941 C -> U 953 C -> U 982 C -> U 1015 U -> C 1046 C -> U 1048 U -> C 1127 U -> C
 
 Edited sequence 

AUGUCACCACAAACGGAGACUAAAGCAGGUGUUGGAUUUAAAGCUGGUGUUAAAGAUUAUAGAUUAACCU AUUAUACCCCUGAUUACGAGACCAAGGAUACUGAUAUUUUGGCAGCGUUUCGAAUGACUCCUCAACCAGG GGUGCCACCUGAAGAAGCAGGAGCCGCAGUAGCUGCUGAAUCUUCAACUGGUACAUGGACUACUGUUUGG ACCGAUGGACUUACCAGCCUUGACCGUUACAAAGGUCGAUGCUACGACAUUGAACCUGUUGCUGGAGAGG AAAAUCAAUAUAUUGCUUAUGUUGCUUAUCCUUUAGAUUUGUUUGAGGAGGGUUCUGUUACCAACAUGUU CACUUCCAUUGUAGGUAAUGUUUUUGGAUUUAAAGCUUUACGAGCUUUACGUCUAGAAGAUUUACGAAUU CCACCUGCUUAUUCCAAAACCUUUCAAGGUCCACCUCAUGGUAUUCAAGUUGAAAGAGAUAAAUUGAAUA AAUAUGGUCGUCCUUUAUUAGGAUGUACCAUUAAACCAAAGUUAGGUUUAUCUGCCAAAAACUAUGGUAG AGCUGUAUAUGAAUGUCUUCGUGGUGGACUUGAUUUCACCAAAGAUGACGAAAAUGUUAAUUCUCAACCU UUUAUGCGUUGGAGAGAUCGUUUUCUAUUCGUAGCAGAAGCUAUUUUUAAAUCUCAAGCUGAAACAGGGG AGAUUAAAGGGCAUUACUUAAAUGCCACUGCAGGUACAUGUGAGGAAAUGAUGAAAAGGGCACAUUUUGC UAGAGAAUUAGGAAUGCCUAUCGUAAUGCAUGAUUAUUUGACAGGAGGUUUUACUGCAAAUACGACCCUG GCUCGUUAUUGUAGAGACAAUGGUUUACUUCUUCAUAUUCAUCGUGCCAUGCAUGCAGUUAUUGACAGAC AAAGAAAUCAUGGUAUUCACUUUCGUGUAUUAGCUAAAGCAUUACGUAUGUCCGGGGGAGAUCAUAUUCA UUCAGGUACAGUAGUAGGUAAAUUAGAGGGAGAACGUGAAGUAACUUUAGGUUUUGUGGAUUUACUUCGU GACGAUUAUAUUGAAAAAGAUAGAAGUCGUGGGAUAUAUUUUACUCAAGACUGGGUCUCUAUGCCUGGUG UUUUGCCCGUGGCUUCAGGUGGUAUUCAUGUUUGGCAUAUGUCAGCUUUAACUGAGAUUUUCGGAGAUGA UUCCGUACUACAGUUUGGCGGGGGAACUCUAGGACACCCUUGGGGAAAUGCACCUGGUGCAGUAGCUAAU CGAGUUGCUUUAGAAGCUUGUGUGCAAGCUCGUAAUGAAGGACGUGAUCUUGCUCGCGAGGGUAAUGAUA UUAUCCGUGAAGCUAGUAAAUGGAGUCCUGAAUUAGCAGCUGCUUGUGAAGUAUGGAAAGAAAUUAAAUU CGUUUUUGAGACGAUUGAUACUCUAUAA