Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   324
Gene name   psbT
Locus   AnfoCp055
Organism   Anthoceros formosae
Location Start:End   92788:92910
 
Protein  
MEALVYTFLLVGTLGIIFFAIFFRDPPKVPSKGVPSKGKK
			
    Run BLAST
 
CDS  
ATGGAAGCATTGGTTTATACATTTTTGTTGGTAGGCACTTCAGGAATAATCTTTTTCGCTATTTTTTTTC
GAGACCCACCTAAAGTTCCAAGTAAGGGAGTTCCGAGCAAGGGAAAGAAATAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 41 C -> U
 
 Edited sequence 

AUGGAAGCAUUGGUUUAUACAUUUUUGUUGGUAGGCACUUUAGGAAUAAUCUUUUUCGCUAUUUUUUUUC GAGACCCACCUAAAGUUCCAAGUAAGGGAGUUCCGAGCAAGGGAAAGAAAUAA

 Other edit remarks: 

Protein sequence is in conflict with the conceptual translation