Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   322
Gene name   psbM
Locus   AnfoCp002
Organism   Anthoceros formosae
Location Start:End   832:936
 
Protein  
MEVNILAFIATALFILIPTAFLLILYVQTASQGS
			
    Run BLAST
 
CDS  
ATGGAAGTAAATATTCTTGCCTTTATTGCTACTGCACTCTTCATTTTAATCCCTACTGCTTTTCTACCTA
TTTTTTATGTACAAACAGCTAGTCAAGGCAGTTAG
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 68 C -> U 73 U -> C
 
 Edited sequence 

AUGGAAGUAAAUAUUCUUGCCUUUAUUGCUACUGCACUCUUCAUUUUAAUCCCUACUGCUUUUCUACUUA UUCUUUAUGUACAAACAGCUAGUCAAGGCAGUUAG

 Other edit remarks: 

Protein sequence is in conflict with the conceptual translation