Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   317
Gene name   psbH
Locus   AnfoCp058
Organism   Anthoceros formosae
Location Start:End   93225:93449
 
Protein  
MATQIIDDTPKTKGRRSGIGNILKPLNSEYGKVAPGWGTTPLMGIAMGLFAVFLVIILELYNSSVLLDGV
SVSW
			
    Run BLAST
 
CDS  
ATGGCTACACAAATTATTGATGACACTCCTAAGACTAAAGGGAGACGAAGTGGTATAGGAAATATATCAA
AACCACTTAATTCAGAATATGGTAAAGTCGCTCCCGGATGGGGAACTACTCCTCTAATGGGTATAGCAAT
GGGTTTATTTGCAGTTTCTTCAGTTATTATCTTAGAACCCTATAATTCTTCTGTTTTATTAGATGGAGTT
TCCGTAAGCTGGTAG
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 68 C -> U 158 C -> U 161 C -> U 179 C -> U
 
 Edited sequence 

AUGGCUACACAAAUUAUUGAUGACACUCCUAAGACUAAAGGGAGACGAAGUGGUAUAGGAAAUAUAUUAA AACCACUUAAUUCAGAAUAUGGUAAAGUCGCUCCCGGAUGGGGAACUACUCCUCUAAUGGGUAUAGCAAU GGGUUUAUUUGCAGUUUUUUUAGUUAUUAUCUUAGAACUCUAUAAUUCUUCUGUUUUAUUAGAUGGAGUU UCCGUAAGCUGGUAG

 Other edit remarks: 

Protein sequence is in conflict with the conceptual translation