Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   314
Gene name   psbD
Locus   AnfoCp023
Organism   Anthoceros formosae
Location Start:End   50032:51093
 
Protein  
MTIAIGKSSEEPKGLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLE
GCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFGLIGFMLRQFELARSVQLR
PYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAAL
LCAIHGATVENTLFEDGDGANTFRAFNPTQSEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGL
WMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRG
NAL
			
    Run BLAST
 
CDS  
ATGACTATAGCCATTGGAAAGTCTTCTGAAGAACCAAAAGGTTTATTTGATAGTATGGATGACTGGTTAA
GAAGAGATTGCTTCGTATTTGTAGGTTGGTCCGGCTTATTGCTGTTTCCTTGTGCTTATTTTGCTTTAGG
TGGATGGTTTACAGGTACGACTTTCGTAACTTCACGGTATACTCATGGATTAGCTAGTTCTTACTTAGAG
GGCTGTAATTTCTTGACCGCCGCGGTTTCTACCCCTGCTAATAGTTTAGCACATTCTCTATTGCTTCTAT
GGGGTCCTGAAGCACAAGGAGATTTCACTCGTTGGTGCCAACTAGGCGGTCTATGGACCTTTGTGGCTCT
CCATGGTGCTTTTGGTTTAATAGGCTTCATGTTATGCCAATTCGAACTAGCTAGATCTGTGTAATTACGT
CCTTATAATGCCATTGCATCTTCTGGTCCAATTGCAGTTTTTGTTTCCGTATTCTTGATCTATCCTTTGG
GTCAGTCTGGTTGGTTTTTTGCACCCAGTTTCGGTGTAGCAGCTATCTCTCGATTCATTCTTTTCTTCTA
AGGTTTCCATAACTGGACTTTAAACCCGTTTCATATGATGGGAGTTGCTGGAGTTTTAGGTGCTGCTTTA
TTATGTGCTATTTATGGGGCTACAGTGGAGAATACTTTGTTTGAGGATGGTGATGGTGCAAATACATTCC
GTGCTTTCAACCCAACTCAATCTGAAGAAACTTATTCTATGGTAACTGCTAATAGATTTTGGTCTCAGAT
CTTCGGTGTTGCTTTCCCTAACAAGCGTTGGTTACACTTTTTCATGTTATTCGTACCAGTAACTGGTTTA
TGGATGAGTGCTATTGGAGTCGTTGGTTTAGCCTTAAACTTACGAGCATATGATTTTGTATCTCAAGAGA
TTCGTGCAGCGGAGGATCCTGAATCTGAAACTTTCTACACTAAAAATATTCTTCTGAATGAAGGTATTCG
TGCTTGGATGGCGGCTCAAGATCAGCCTCATGAAAACCTTGTATTCCCTGAGGAGGTATTACCCTGTGGA
AACGCTCTTTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 79 U -> C 175 C -> U 385 U -> C 412 U -> C 440 C -> U 539 C -> U 559 U -> C 643 U -> C 787 C -> U 935 C -> U 1045 U -> C
 
 Edited sequence 

AUGACUAUAGCCAUUGGAAAGUCUUCUGAAGAACCAAAAGGUUUAUUUGAUAGUAUGGAUGACUGGUUAA GAAGAGAUCGCUUCGUAUUUGUAGGUUGGUCCGGCUUAUUGCUGUUUCCUUGUGCUUAUUUUGCUUUAGG UGGAUGGUUUACAGGUACGACUUUCGUAACUUCAUGGUAUACUCAUGGAUUAGCUAGUUCUUACUUAGAG GGCUGUAAUUUCUUGACCGCCGCGGUUUCUACCCCUGCUAAUAGUUUAGCACAUUCUCUAUUGCUUCUAU GGGGUCCUGAAGCACAAGGAGAUUUCACUCGUUGGUGCCAACUAGGCGGUCUAUGGACCUUUGUGGCUCU CCAUGGUGCUUUUGGUUUAAUAGGCUUCAUGUUACGCCAAUUCGAACUAGCUAGAUCUGUGCAAUUACGU CCUUAUAAUGCCAUUGCAUUUUCUGGUCCAAUUGCAGUUUUUGUUUCCGUAUUCUUGAUCUAUCCUUUGG GUCAGUCUGGUUGGUUUUUUGCACCCAGUUUCGGUGUAGCAGCUAUCUUUCGAUUCAUUCUUUUCUUCCA AGGUUUCCAUAACUGGACUUUAAACCCGUUUCAUAUGAUGGGAGUUGCUGGAGUUUUAGGUGCUGCUUUA UUAUGUGCUAUUCAUGGGGCUACAGUGGAGAAUACUUUGUUUGAGGAUGGUGAUGGUGCAAAUACAUUCC GUGCUUUCAACCCAACUCAAUCUGAAGAAACUUAUUCUAUGGUAACUGCUAAUAGAUUUUGGUCUCAGAU CUUCGGUGUUGCUUUCUCUAACAAGCGUUGGUUACACUUUUUCAUGUUAUUCGUACCAGUAACUGGUUUA UGGAUGAGUGCUAUUGGAGUCGUUGGUUUAGCCUUAAACUUACGAGCAUAUGAUUUUGUAUCUCAAGAGA UUCGUGCAGCGGAGGAUCCUGAAUUUGAAACUUUCUACACUAAAAAUAUUCUUCUGAAUGAAGGUAUUCG UGCUUGGAUGGCGGCUCAAGAUCAGCCUCAUGAAAACCUUGUAUUCCCUGAGGAGGUAUUACCCCGUGGA AACGCUCUUUAA