Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   313
Gene name   psbC
Locus   AnfoCp024
Organism   Anthoceros formosae
Location Start:End   51041:52462
 
Protein  
MKTLYSLRRYYPVETLFNGTLALGGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLF
EVAHFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHSLIGPETL
EESFPFFGYVWKDKNKMTTILGIHLVLLGLGAFLLVFKASFFGGVYDTWAPGGGDVREITNLTLSPSIIF
GYLLKSPFGGEGWIVSVDNLEDIIGGHVWLGLICILGGIWHILTKPFAWARRALVWSGEAYLSYSLGAIS
VFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEII
FGGETMRFWDLRAPWLEPLRGPNGLDLSKLKQDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYV
SPRSWLATSHFVLGFFFFVGHLWHAGRARAAAAGFEKGIDRDSEPVLSMTPLN
			
    Run BLAST
 
CDS  
ATGAAAACCTTGTATTCCCTGAGGAGGTATTACCCTGTGGAAACGCTCTTTAATGGAACTTTAGCTTTGG
GTGGTCGTGATCAAGAAACCACTGGTTTCGCTTGGTGGGCTGGTAATGCTCGACTTATCAATTTATCTGG
TAAATTATTAGGTGCTCATGTAGCTTATGCTGGCTTGATAGTTTTTTGGGCTGGAGCGATGAATCTATTT
GAAGTGGCTCACTTTGTACCGGAAAAACCCATGTATGAGCAGGGATTAATTTTATTGCCGCATCTAGCTA
CTTTAGGGTGGGGTGTAGGTCCCGGTGGAGAAGTTATCGATACTTTTCCATACTTCGTATCTGGTGTACT
CCATTTAATTTCGTCCGCAGTTTTAGGTTTCGGAGGTATCTATCATTCTCTTATTGGACCAGAAACCTTA
GAAGAATCTTTTCCATTCTTTGGTTATGTATGGAAAGATAAGAATAAAATGACTACTATTCTAGGTATTC
ATCTTGTTTTACTAGGTCTTGGTGCTTCTCTCCTGGTATTCAAGGCTTCATTTTTCGGAGGTGTATACGA
TACCTGGGTTCCTGGTGGTGGAGATGTAAGAGAAATCACAAATCTTACACTTAGTCCGAGTATTATTTTT
GGGTATTTACTCAAGTCACCTTTTGGTGGAGAGGGATGGATTGTTAGTGTGGATAATTTGGAAGATATAA
TCGGCGGACATGTTTGGTTAGGCTTGATTTGTATCCTAGGTGGTATCTGGCATATCTTGACCAAACCCTT
TGCGTGGGCCCGCCGTGCTTTAGTATGGTTCGGAGAAGCCTATCTATCTTATAGTTTAGGCGCTATTTCT
GTTTTTGGTTTCATTGCTTGTTGCTTTGTTTGGTTTAATAACACAGCTTATCCTAGTGAATTTTATGGTC
CTACTGGTCCAGAAGCTTCTCAAGCTCAAGCTTTTACTTTTTTGGTTAGAGACCAACGCCTCGGAGCTAA
TGTAGGTTCTGCCCAAGGACCTACCGGTTTAGGTAAATATCTTATGCGCCCTCCTACTGGAGAAATCATT
TTTGGAGGAGAAACAATGCGCTTTTGGGATCTCCGTGCTCCATGGTTGGAACCTCTAAGAGGTCCCAATG
GCTTAGATTTGAGTAAGTTGAAGCAAGATATACAGCCCTGGCAGGAGTGACGTTCCGCAGAATATATGAC
TCATGCTCCTTTGGGTTCTTTGAATTCTGTAGGTGGAGTAGCTACTGAAATTAATGCAGTAAACTATGTT
TCTCCCCGTAGTTGGTTAGCCACCTCTCATTTTGTATTGGGATTCTTTTTTTTCGTAGGTCACTTGTGGC
ACGCCGGGAGAGCACGTGCAGCTGCAGCTGGATTCGAAAAAGGGATTGATCGTGATTCCGAACCTGTTCT
TTCTATGACACTTCTTAACTAG
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 36 U -> C 166 U -> C 518 C -> U 569 U -> C 800 U -> C 1030 C -> U 1168 U -> C 1412 U -> C
 
 Edited sequence 

AUGAAAACCUUGUAUUCCCUGAGGAGGUAUUACCCCGUGGAAACGCUCUUUAAUGGAACUUUAGCUUUGG GUGGUCGUGAUCAAGAAACCACUGGUUUCGCUUGGUGGGCUGGUAAUGCUCGACUUAUCAAUUUAUCUGG UAAAUUAUUAGGUGCUCAUGUAGCUCAUGCUGGCUUGAUAGUUUUUUGGGCUGGAGCGAUGAAUCUAUUU GAAGUGGCUCACUUUGUACCGGAAAAACCCAUGUAUGAGCAGGGAUUAAUUUUAUUGCCGCAUCUAGCUA CUUUAGGGUGGGGUGUAGGUCCCGGUGGAGAAGUUAUCGAUACUUUUCCAUACUUCGUAUCUGGUGUACU CCAUUUAAUUUCGUCCGCAGUUUUAGGUUUCGGAGGUAUCUAUCAUUCUCUUAUUGGACCAGAAACCUUA GAAGAAUCUUUUCCAUUCUUUGGUUAUGUAUGGAAAGAUAAGAAUAAAAUGACUACUAUUCUAGGUAUUC AUCUUGUUUUACUAGGUCUUGGUGCUUUUCUCCUGGUAUUCAAGGCUUCAUUUUUCGGAGGUGUAUACGA UACCUGGGCUCCUGGUGGUGGAGAUGUAAGAGAAAUCACAAAUCUUACACUUAGUCCGAGUAUUAUUUUU GGGUAUUUACUCAAGUCACCUUUUGGUGGAGAGGGAUGGAUUGUUAGUGUGGAUAAUUUGGAAGAUAUAA UCGGCGGACAUGUUUGGUUAGGCUUGAUUUGUAUCCUAGGUGGUAUCUGGCAUAUCUUGACCAAACCCUU UGCGUGGGCCCGCCGUGCUUUAGUAUGGUCCGGAGAAGCCUAUCUAUCUUAUAGUUUAGGCGCUAUUUCU GUUUUUGGUUUCAUUGCUUGUUGCUUUGUUUGGUUUAAUAACACAGCUUAUCCUAGUGAAUUUUAUGGUC CUACUGGUCCAGAAGCUUCUCAAGCUCAAGCUUUUACUUUUUUGGUUAGAGACCAACGCCUCGGAGCUAA UGUAGGUUCUGCCCAAGGACCUACCGGUUUAGGUAAAUAUCUUAUGCGCUCUCCUACUGGAGAAAUCAUU UUUGGAGGAGAAACAAUGCGCUUUUGGGAUCUCCGUGCUCCAUGGUUGGAACCUCUAAGAGGUCCCAAUG GCUUAGAUUUGAGUAAGUUGAAGCAAGAUAUACAGCCCUGGCAGGAGCGACGUUCCGCAGAAUAUAUGAC UCAUGCUCCUUUGGGUUCUUUGAAUUCUGUAGGUGGAGUAGCUACUGAAAUUAAUGCAGUAAACUAUGUU UCUCCCCGUAGUUGGUUAGCCACCUCUCAUUUUGUAUUGGGAUUCUUUUUUUUCGUAGGUCACUUGUGGC ACGCCGGGAGAGCACGUGCAGCUGCAGCUGGAUUCGAAAAAGGGAUUGAUCGUGAUUCCGAACCUGUUCU UUCUAUGACACCUCUUAACUAG