Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   312
Gene name   psbB
Locus   AnfoCp054
Organism   Anthoceros formosae
Location Start:End   91107:92633
 
Protein  
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLG
ITKSWGGWSITGETVTNAGIWSYEGVAAVHIVLSGLLFLAAIWHWVYWDLELFRDERTGKPSLDLPKIFG
IHLFLSGVLCFGFGAFHVTGLFGPGIWVSDPYGLTGKVEPVAPAWGAEGFDPFVPGGIASHHIAAGILGI
LAGLFHLSVRPPQRLYKGLRMGNVETVLSSSIAAVFFAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFF
QQEIDRRIRSSKAENLSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDKE
GHELFVRRMPTFFETFPVVLVDEEGIVRADIPFRRAESKYSVEQVGVIVEFYGGELDGVSFSDPVTVKKY
ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFAGIDSDLDAQV
EFGAFEKLGDPTTKRQVV
			
    Run BLAST
 
CDS  
ATGGGTTTACCTCGGTATCGTGTTCATACGGTCGTACCAAATGATCTTGGCTGTTTAATTGTAGTACATC
TAATGCATACTGCTTTAGTTTCTGGTTGGGCCGGTTCTATGGCTTTGTATGAATTAGCAGTTTTTGATCC
TTCTGATCCCGTTCTTGATTTAATGTGGAGACAGGGCATGTTTGTTATACTTTTTATGACTCGTCTAGGA
ATTACAAAATCTTGGGGTGGTTGGAGTATTACTGGAGAAACTGTGACTAATGCAGGTATTTGGAGTTACG
AGGGTGTTGCCGCGGTTTATATCGTACCATTTGGCTTGTCATTCTTGGCAGCTATTTGGCATTGGGTATA
TTGGGATTCGGAATCATTTCGTGACGAACGTACAGGAAAACCTTTTTCAGATTCGCCTAAAATTTTTGGA
ATTCATTTATTCCTTTCAGGAGTACTTTGTTTTGGATTTGGAGCATCTCATGTAACAGGTTTATTCGGTC
CAGGAATATGGGTTTCCGATCCTTATGGACTAACGGGAAAGGTAGAACCAGTGGCTCCAGCTTGGGGAGC
AGAAGGTTTCGATCCCTTCGTTCCTGGGGGAATAGCCTCTCATCATATCGCAGCAGGTATTTTAGGTATA
TTAGCAGGCCTATTCTATCTTAGTGTTCGTCCCTTTCAAAGGTTATACAAAGGATTACGTATGGGTAATG
TTGAAACTGTTTTATCTAGCAGTATCGCTGCTGTATTTTTTGCAGCTTTCGTAGTTGCTGGAACAATGTG
GTACGGGTCTGCAGCTACTTCAATAGAATCATCTGGTCCTACTCGTTACCAATGGGACTAAGGTTTCTTC
CAACAAGAAATAGATCGTAGGATTCGTTCTAGCAAGGCTGAGAATCTTAGTTTATCAGAAGCTTGGTCTA
AAATTCCTGAAAAATTAGCGTTTTACGATTATATTGGTAACAATTCAGCTAAAGGGGGATTATTTAGAGC
AGGTGCAATGGATAATGGAGATGGAATAGCTGTTGGTTGGTTAGGTTACGCTGTCTTTAAAGATAAAGAA
GGGCATGAACTCTTCGTACGTCGTATGCCTACTTTTTCTGAAACGTTTCCAGTAGTTCCAGTAGATGAAG
AAGGAATTGTTAGAGCAGATATCTCATCTAGGAGAGCAGAATCTAAATATAGTGTTGAGCAAGTAGGTGT
AATTGTTGAATTTTACGGTGGTGAACTCGATGGTGTTAGTTTTAGCGATCCTGTTACAGTGAAGAAGTAT
GCTAGATGTGCTTAATTGGGTGAAATTTCTGAATCTGATAGGGCTACTTTAAAGTCTGATGGTGTCTCCC
GTAGTAGTCCAAGAGGTTGGTTTACTTTTGGTCACGCTACATTTGCTCTTCCTTCCTCCTTCGGGCATAT
CTGGCACGGTGCCAGAACTCTGTTCAGAGATGTTTTTGCCGGTATTGACTCAGATTTAGATGCTCAAGTT
GAATTTGGAGCTTTTGAAAAATTGGGAGATCCAACTACTAAGAGACAAGTGGTGTGA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 13 C -> U 38 C -> U 47 U -> C 52 U -> C 62 U -> C 160 U -> C 161 U -> C 191 U -> C 298 U -> C 308 C -> U 311 U -> C 320 C -> U 359 C -> U 365 C -> U 395 U -> C 398 C -> U 404 C -> U 467 C -> U 646 U -> C 664 U -> C 665 U -> C 790 U -> C 800 C -> U 803 C -> U 829 U -> C 955 U -> C 1027 U -> C 1088 C -> U 1109 C -> U 1144 U -> C 1148 C -> U 1267 U -> C 1273 U -> C 1289 C -> U 1295 C -> U 1328 C -> U 1382 C -> U 1385 C -> U 1388 C -> U
 
 Edited sequence 

AUGGGUUUACCUUGGUAUCGUGUUCAUACGGUCGUACUAAAUGAUCCUGGCCGUUUAAUUGCAGUACAUC UAAUGCAUACUGCUUUAGUUUCUGGUUGGGCCGGUUCUAUGGCUUUGUAUGAAUUAGCAGUUUUUGAUCC UUCUGAUCCCGUUCUUGAUCCAAUGUGGAGACAGGGCAUGUUUGUUAUACCUUUUAUGACUCGUCUAGGA AUUACAAAAUCUUGGGGUGGUUGGAGUAUUACUGGAGAAACUGUGACUAAUGCAGGUAUUUGGAGUUACG AGGGUGUUGCCGCGGUUCAUAUCGUACUAUCUGGCUUGUUAUUCUUGGCAGCUAUUUGGCAUUGGGUAUA UUGGGAUUUGGAAUUAUUUCGUGACGAACGUACAGGAAAACCUUCUUUAGAUUUGCCUAAAAUUUUUGGA AUUCAUUUAUUCCUUUCAGGAGUACUUUGUUUUGGAUUUGGAGCAUUUCAUGUAACAGGUUUAUUCGGUC CAGGAAUAUGGGUUUCCGAUCCUUAUGGACUAACGGGAAAGGUAGAACCAGUGGCUCCAGCUUGGGGAGC AGAAGGUUUCGAUCCCUUCGUUCCUGGGGGAAUAGCCUCUCAUCAUAUCGCAGCAGGUAUUUUAGGUAUA UUAGCAGGCCUAUUCCAUCUUAGUGUUCGUCCCCCUCAAAGGUUAUACAAAGGAUUACGUAUGGGUAAUG UUGAAACUGUUUUAUCUAGCAGUAUCGCUGCUGUAUUUUUUGCAGCUUUCGUAGUUGCUGGAACAAUGUG GUACGGGUCUGCAGCUACUCCAAUAGAAUUAUUUGGUCCUACUCGUUACCAAUGGGACCAAGGUUUCUUC CAACAAGAAAUAGAUCGUAGGAUUCGUUCUAGCAAGGCUGAGAAUCUUAGUUUAUCAGAAGCUUGGUCUA AAAUUCCUGAAAAAUUAGCGUUUUACGAUUAUAUUGGUAACAAUCCAGCUAAAGGGGGAUUAUUUAGAGC AGGUGCAAUGGAUAAUGGAGAUGGAAUAGCUGUUGGUUGGUUAGGUCACGCUGUCUUUAAAGAUAAAGAA GGGCAUGAACUCUUCGUACGUCGUAUGCCUACUUUUUUUGAAACGUUUCCAGUAGUUCUAGUAGAUGAAG AAGGAAUUGUUAGAGCAGAUAUCCCAUUUAGGAGAGCAGAAUCUAAAUAUAGUGUUGAGCAAGUAGGUGU AAUUGUUGAAUUUUACGGUGGUGAACUCGAUGGUGUUAGUUUUAGCGAUCCUGUUACAGUGAAGAAGUAU GCUAGACGUGCUCAAUUGGGUGAAAUUUUUGAAUUUGAUAGGGCUACUUUAAAGUCUGAUGGUGUCUUCC GUAGUAGUCCAAGAGGUUGGUUUACUUUUGGUCACGCUACAUUUGCUCUUCUUUUCUUCUUCGGGCAUAU CUGGCACGGUGCCAGAACUCUGUUCAGAGAUGUUUUUGCCGGUAUUGACUCAGAUUUAGAUGCUCAAGUU GAAUUUGGAGCUUUUGAAAAAUUGGGAGAUCCAACUACUAAGAGACAAGUGGUGUGA