Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   302
Gene name   petG
Locus   AnfoCp047
Organism   Anthoceros formosae
Location Start:End   84729:84842
 
Protein  
MVEALLSGIVLGLIPITLAGLFVTAYLQYRRGDQLDL
			
    Run BLAST
 
CDS  
ATGGTTGAAGCTTTGCTGTCTGGAATAGTATTAGGTTTGATCCCAATAACTTTGGCTGGATTATCCGTAA
CTGTGTATCTATAATATCGGTGTGGTGATCAATTAGATTTGCAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 65 C -> U 74 U -> C 82 U -> C 91 U -> C 112 C -> U
 
 Edited sequence 

AUGGUUGAAGCUUUGCUGUCUGGAAUAGUAUUAGGUUUGAUCCCAAUAACUUUGGCUGGAUUAUUCGUAA CUGCGUAUCUACAAUAUCGGCGUGGUGAUCAAUUAGAUUUGUAA