Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   301
Gene name   petD
Locus   AnfoCp060
Organism   Anthoceros formosae
Location Start:End   95393:95400|96092:96566
 
Protein  
MGVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPSMIGEPANPFA
TPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKFQNPFRRPVATTIFLIGTAVA
IWLGIGAALPIDKSLTLGLS
			
    Run BLAST
 
CDS  
ATGGGAGTAACAAAGAAACCCGATTTAAGTGATCCTGTATTAAGGGTTAAATTAGCTAAAGGTATGGGAC
ATAATTATTATGGAGAACTTGCTTGGCCTAATGATTCTTCACATATCTCTTTAGTAGTAATTTTAGGTAC
TATTGCATGTACTGTCGGTTTAGCCGTCTTAGAACCTTCTATGATTGGTGAACCGGCAAATCCATTTGCT
ACCCTTCTAGAAATATTGCCTGAATGGTATTTCTTTCCTGTATCTTAAATACCCTGTACAGTACCTAATA
AACTATTAGGTGTTCTTCTAATGGCTGCAGTACTTGCGGGATTATTAACAGTACCTTTTTTAGAAAATGC
TAATAAATTTTAAAATTCGTTTCGTCGTCCAGTAGCTACAACAATTTTTCCGATTGGTACTGCAGTAGCT
ATTTGGCTGGGAATTGGGGCAGCTCTACCTATTGATAAATCATTAACTTTAGGTCTTTCTCAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 39 U -> C 81 U -> C 98 U -> C 99 C -> U 102 C -> U 104 C -> U 111 C -> U 113 U -> C 114 U -> C 207 U -> C 246 C -> U 248 U -> C 255 C -> U 257 U -> C 306 U -> C 342 C -> U 353 U -> C 359 U -> C 391 U -> C 392 C -> U 393 C -> U 473 C -> U
 
 Edited sequence 

AUGGGAGUAUGGGAGUAACAAAGAAACCCGAUUUAAGUGAUCCUGUCUUAAGGGUUAAAUUAGCUAAAGG UAUGGGACAUAAUUAUUACGGAGAACUUGCUUGGCCUAAUGUUUCUUCUCCCAUCUCUUUAGUAGUAAUU UUAGGUACUAUUGCAUGUACUGUCGGUUUAGCCGUCUUAGAACCUUCUAUGAUUGGUGAACCGGCAAAUC CAUUCGCUACCCUUCUAGAAAUAUUGCCUGAAUGGUAUUUCUUUCCUGUAUCUUCAAUACCCUGUACAGU ACCUAAUAAACUAUUAGGUGUUCUUCUAAUGGCCGCAGUACUUGCGGGAUUAUUAACAGUACCUUUUUUU GAAAAUGCUACUAAAUCUUAAAAUUCGUUUCGUCGUCCAGUAGCUACACUUAUUUUUCCGAUUGGUACUG CAGUAGCUAUUUGGCUGGGAAUUGGGGCAGCUCUACCUAUUGAUAAAUCAUUAACUUUAGUUC