Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   300
Gene name   petB
Locus   AnfoCp059
Organism   Anthoceros formosae
Location Start:End   93677:93682|94490:95131
 
Protein  
MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVASGFAMTFYYRPTVTEAFASVQ
YIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVILAVLTVSFGVTGYSLPW
DQIGYWAVKIVTGVPEAIPLVGSSLVELLRGSVSVGQSTLTRFYSLHTFVLPLLTAVLMLMHFLMIRKQG
ISGPL
			
    Run BLAST
 
CDS  
ATGGGTAAAGTATACGATTGGTTCGAGGAACGTCTAGAAATTCAAGCGATTGCGGATGATATAACTAGTA
AATATGTTTTTCCTCATGTGAATATATCTTATTGTTTAGGTGGAATTACATTAACTTGTTTCCTAGTACA
AGTAGCTAGTGGTTTTGCGATGACTTTCTACCATCGTCTAACAGTTACAGAAGCTTTTGCTTCTGTTCAA
TACATAATGACTGAAGTTAACTTTGGTTGGTTAATTAGATCAGTTCATAGATGGTTAGCCAGTATGATGG
TTTCAATGATGATTCCACATGTATTTTGCGTGTATCTTACAGGTGGTTTCAAAAAACTTCGTGAATTGAC
TTGGGTTACAGGTGTAATTTCAGCTGTATCAACGGTTTCTTTCGGTGTAACTGGTTATTCCTTACCTTGG
GATTAAATTGGTTATTGGGCCGTAAAAATAGTGACTGGTGTACCTGAGGCTATTTCTTTAGTGGGATCCT
CCTTAGTTGAGTTACTACGTGGAAGTGTTAGTGTGGGTTAATCTACATTGACTCGTTTTTATAGTTTACA
TATTTTTGTATCACCTCCCCTTACTGCTGTACCTATGTCAATGCATTCCTTGATGATCCGTAAGCAAGGT
ATATCGGGTCTATTATGA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 73 U -> C 74 U -> C 92 C -> U 166 C -> U 173 U -> C 260 U -> C 278 C -> U 290 C -> U 301 U -> C 332 U -> C 365 C -> U 374 C -> U 418 U -> C 469 U -> C 523 U -> C 557 U -> C 566 C -> U 572 C -> U 587 C -> U 593 C -> U 602 C -> U 635 U -> C
 
 Edited sequence 

AUGGGUAUGGGUAAAGUAUACGAUUGGUUCGAGGAACGUCUAGAAAUUCAAGCGAUUGCGGAUGAUAUAA CUAGUAAACCUGUUUUUCCUCAUGUGAUUAUAUCUUAUUGUUUAGGUGGAAUUACAUUAACUUGUUUCCU AGUACAAGUAGCUAGUGGUUUUGCGAUGACUUUCUACCCUCGUCUAACAGUUACAGAAGCUUUUGCUUCU GUUCAAUACAUAAUGACUGAAGUUAACUUUGGUUGGUUAAUUAGAUCAGUUCAUACAUGGUUAGCCAGUA UGAUGGUUUCAAUGAUGAUUCCACAUCUAUUUUGCGUGUAUCUUACAGGUGGUUUCACAAAACUUCGUGA AUUGACUUGGGUUACAGGUGUAAUUUCAGUUGUAUCAACGGUUUCUUUCGGUGUAACUGGUUAUUCCUUA CCUCGGGAUUAAAUUGGUUAUUGGGCCGUAAAAAUAGUGACUGGUGUACCUGAGCCUAUUUCUUUAGUGG GAUCCUCCUUAGUUGAGUUACUACGUGGAAGUGUUAGUCUGGGUUAAUCUACAUUGACUCGUUUUUAUAG UUCACAUAUUUUUGUAUUACCUCCCCUUACUGUUGUACUUAUGUCAAUGCAUUCCUUGAUGAUCCGUAAG CAAGGUAUAUCGGGUCUA