Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   299
Gene name   petA
Locus   AnfoCp041
Organism   Anthoceros formosae
Location Start:End   79362:80330
 
Protein  
MQNRKTYAYDWIKKWMIKSISTLIIINTMVWSSVSEAYPIFAQQGYENPREATGRIVCANCHLAKKPVDI
EVPQSVLPDTVFEAVVKIPYDTQVKQVLANGKKGALNVGAVLILPEGFELAPSNRVPPEMKEKIGNLYFQ
SYRPDKKNILVVGPVPGKKYSEIIFPILAPNPATNKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNA
STTGIIKKVLRKEKGGYEIIIDNTLDGRQVIDIVPPGPELIISEGESIKVDQPLTNNPNVGGFGQGDAEI
VLQDVLRVQGLLLFFASVILAQIFLVLKKKQFEKVQLAEMNF
			
    Run BLAST
 
CDS  
ACGCAAAACAGAAAAACTTATGCTTATGATTGGATAAAGAAATGGATGATTAAATTAATTTCAACGCTGA
TAATTATAAATACAATGGTTTGGTCTTCTGTCTCAGAAGCATACCCCATCTTTGCACAGCAAGGTTATGA
AAATCCTCGAGAAGCAATTGGACGTATTGTATGTGCTAATTGTCATTTAGCGAAAAAACCAGTGGATATT
GAAGTTCCATAGTCTGTACTTCCGGATACTGTATTTGAGGCAGTCGTTAAAATTCCTTACGATACCCAAG
TAAAATAAGTACTTGCTAATGGTAAGAAAGGAGCTTTAAATGTAGGAGCTGTTCTTATTTTACCGGAAGG
ATTCGAATTAGCCCCTTCTAATCGGGTTCCCCCCGAAATGAAAGAAAAAATAGGTAATCTTTATTTCCAA
AGTTATCGTCCTGATAAGAAGAATATTCTTGTAGTAGGTCCGGTTCCTGGTAAGAAATACAGTGAAATCA
TATTTCCCATTCTTGCACCGAATCCTGCAACTAATAAAGATGCTCATTTTTTAAAATATCCTATATATGT
GGGTGGTAATAGAGGAAGGGGATAGATTTATCCTGATGGAAGTAAAAGCAACAATACAGTTTATAATGCT
TCAACGACAGGTATAATTAAAAAAGTTTTACGTAAAGAAAAAGGTGGATATGAAATAATTATTGATAATA
CATTAGATGGTCGTCAAGTTATTGATATCGTACCTTCAGGACCAGAACTCATTATTTCAGAGGGGGAATC
CATAAAGGTGGATCAACCTTTAACAAATAATCCTAATGTTGGTGGATTTGGTTAAGGAGATGCAGAAATA
GTACCTCAAGATGTATTACGTGTTCAAGGTCTTTCGTTATTCTCCGCATCAGTTATCTTAGCACAGATAT
TTCTAGTATTGAAAAAGAAACAATTTGAAAAAGTTCAATTAGCTGAAATGAATTTTTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 2 C -> U 56 U -> C 158 U -> C 220 U -> C 286 U -> C 583 U -> C 736 U -> C 823 U -> C 845 C -> U 875 C -> U 884 C -> U
 
 Edited sequence 

AUGCAAAACAGAAAAACUUAUGCUUAUGAUUGGAUAAAGAAAUGGAUGAUUAAAUCAAUUUCAACGCUGA UAAUUAUAAAUACAAUGGUUUGGUCUUCUGUCUCAGAAGCAUACCCCAUCUUUGCACAGCAAGGUUAUGA AAAUCCUCGAGAAGCAACUGGACGUAUUGUAUGUGCUAAUUGUCAUUUAGCGAAAAAACCAGUGGAUAUU GAAGUUCCACAGUCUGUACUUCCGGAUACUGUAUUUGAGGCAGUCGUUAAAAUUCCUUACGAUACCCAAG UAAAACAAGUACUUGCUAAUGGUAAGAAAGGAGCUUUAAAUGUAGGAGCUGUUCUUAUUUUACCGGAAGG AUUCGAAUUAGCCCCUUCUAAUCGGGUUCCCCCCGAAAUGAAAGAAAAAAUAGGUAAUCUUUAUUUCCAA AGUUAUCGUCCUGAUAAGAAGAAUAUUCUUGUAGUAGGUCCGGUUCCUGGUAAGAAAUACAGUGAAAUCA UAUUUCCCAUUCUUGCACCGAAUCCUGCAACUAAUAAAGAUGCUCAUUUUUUAAAAUAUCCUAUAUAUGU GGGUGGUAAUAGAGGAAGGGGACAGAUUUAUCCUGAUGGAAGUAAAAGCAACAAUACAGUUUAUAAUGCU UCAACGACAGGUAUAAUUAAAAAAGUUUUACGUAAAGAAAAAGGUGGAUAUGAAAUAAUUAUUGAUAAUA CAUUAGAUGGUCGUCAAGUUAUUGAUAUCGUACCUCCAGGACCAGAACUCAUUAUUUCAGAGGGGGAAUC CAUAAAGGUGGAUCAACCUUUAACAAAUAAUCCUAAUGUUGGUGGAUUUGGUCAAGGAGAUGCAGAAAUA GUACUUCAAGAUGUAUUACGUGUUCAAGGUCUUUUGUUAUUCUUCGCAUCAGUUAUCUUAGCACAGAUAU UUCUAGUAUUGAAAAAGAAACAAUUUGAAAAAGUUCAAUUAGCUGAAAUGAAUUUUUAA