Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   298
Gene name   ORF51
Locus   AnfoCp018
Organism   Anthoceros formosae
Location Start:End   27724:27879
 
Protein  
MNLIFGFVQLFLYHPLFLLLLYIYLVLFIPLKGAINITNIFPTLLKSIGIK
			
    Run BLAST
 
CDS  
ATGAATTTAATATTTGGTTTTGCACAATTATTCCTCTATCACCCTCTTTTCCTCCTACTTCTATACACTT
ATTTAGTTCTTTTTATTCCACTAAAAGGTGCAATTAATATAACCAATATTTTCCCAACTTTACTTAAATC
CATAGGGATAAAATAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 23 C -> U 61 C -> U 68 C -> U
 
 Edited sequence 

AUGAAUUUAAUAUUUGGUUUUGUACAAUUAUUCCUCUAUCACCCUCUUUUCCUCCUACUUUUAUACAUUU AUUUAGUUCUUUUUAUUCCACUAAAAGGUGCAAUUAAUAUAACCAAUAUUUUCCCAACUUUACUUAAAUC CAUAGGGAUAAAAUAA

 Other edit remarks: 

Protein sequence is in conflict with the conceptual translation