Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   296
Gene name   ORF288
Locus   AnfoCp078
Organism   Anthoceros formosae
Location Start:End   126778:127644
 
Protein  
MSQLIFIPLLISLLVTKGKIRFLNNFESVLALSLHYGILVLALPIFILLYKAKKQPCSILLKVTTEPIIL
SAYATTFSTAFLAITINALFGLIIAWILVKYEFTGKETLDAIVDLPFALPASVGGLTLMTVYSDRGWMGP
ICSGLGLKIVFSRLGVPMATIFVSLPFVVRTIQPVLQDVEEELEEAAWCIGASPWTTFCQISLPLLTPSL
LTGTALGFSRAIGEYGSIVLIACNIPMKDLVISVLIFQKLEQYDYQGAIVVATIVLIASFGGLLIINKVQ
LWKQNLSK
			
    Run BLAST
 
CDS  
ATGAGCCAACTTATTTTTATTCCTCCATTAATTTCACTTTTAGTAACTAAGGGAAAGATTTGATTTTTGA
ATAATTTTGAATCAGTCTTAGCTTTAAGTTTACACTACGGTATTCTCGTATTAGCTTTGCCTATATTTAT
TTCATTATACAAAGCTAAGAAACAACCTTGCAGTATCTTGTTAAAAGTAACTACAGAACCAATAATATTA
CCAGCTTATGCTACTACGTTTTCCACTGCTTTTTCAGCAATTACTACAAACGCTTTATTTGGACTAATCA
TTGCTTGGATTTTGGTTAAATATGAATCTACTGGAAAAGAAACTTTAGATGCTATAGTTGACCTTCTTTT
TGCTCTTCCCGCTTCAGTAGGAGGCCTCACTTCAATGACTGTATATAGTGATAGAGGCTGGATGGGTCCA
ATTTGTTCTGGATTAGGTTTAAAAATAGTTTTTAGTCGTCTAGGAGTTCCTATGGCTACGATCTTCGTAT
CATTACCTTTTGTAGTACGTACCATACAACCAGTTTCGCAAGATGTAGAAGAAGAATTAGAAGAAGCTGC
TTGGTGTATAGGTGCATCACCTTGGACGACTTTTTGTCAAATCTCACTCCCACTTCTAACTCCTTCATTA
TTAACAGGAACAGCTTTAGGTTTCTCAAGAGCTATAGGGGAATATGGTTCAATAGTTTCAATAGCATGTA
ATATTCCTATGAAAGATTTAGTAATTTCCGTACCCATTTTTCAAAAACTTGAACAATATGATTATCAAGG
TGCTATTGTTGTAGCAACCATAGTATTAATAGCTTCTTTCGGTGGATTACCTATAATTAATAAAGTTTAA
TTATGGAAACAAAATTTGAGTAAATGA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 26 C -> U 61 U -> C 143 C -> U 211 C -> U 245 C -> U 257 C -> U 308 C -> U 347 U -> C 383 C -> U 527 C -> U 689 C -> U 734 C -> U 821 C -> U 838 U -> C
 
 Edited sequence 

AUGAGCCAACUUAUUUUUAUUCCUCUAUUAAUUUCACUUUUAGUAACUAAGGGAAAGAUUCGAUUUUUGA AUAAUUUUGAAUCAGUCUUAGCUUUAAGUUUACACUACGGUAUUCUCGUAUUAGCUUUGCCUAUAUUUAU UUUAUUAUACAAAGCUAAGAAACAACCUUGCAGUAUCUUGUUAAAAGUAACUACAGAACCAAUAAUAUUA UCAGCUUAUGCUACUACGUUUUCCACUGCUUUUUUAGCAAUUACUAUAAACGCUUUAUUUGGACUAAUCA UUGCUUGGAUUUUGGUUAAAUAUGAAUUUACUGGAAAAGAAACUUUAGAUGCUAUAGUUGACCUUCCUUU UGCUCUUCCCGCUUCAGUAGGAGGCCUCACUUUAAUGACUGUAUAUAGUGAUAGAGGCUGGAUGGGUCCA AUUUGUUCUGGAUUAGGUUUAAAAAUAGUUUUUAGUCGUCUAGGAGUUCCUAUGGCUACGAUCUUCGUAU CAUUACCUUUUGUAGUACGUACCAUACAACCAGUUUUGCAAGAUGUAGAAGAAGAAUUAGAAGAAGCUGC UUGGUGUAUAGGUGCAUCACCUUGGACGACUUUUUGUCAAAUCUCACUCCCACUUCUAACUCCUUCAUUA UUAACAGGAACAGCUUUAGGUUUCUCAAGAGCUAUAGGGGAAUAUGGUUCAAUAGUUUUAAUAGCAUGUA AUAUUCCUAUGAAAGAUUUAGUAAUUUCCGUACUCAUUUUUCAAAAACUUGAACAAUAUGAUUAUCAAGG UGCUAUUGUUGUAGCAACCAUAGUAUUAAUAGCUUCUUUCGGUGGAUUACUUAUAAUUAAUAAAGUUCAA UUAUGGAAACAAAAUUUGAGUAAAUGA