Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   284
Gene name   ndhB
Locus   AnfoCp093
Organism   Anthoceros formosae
Location Start:End   158893:159615|160281:161060
 
Protein  
MKLDFGSFLSDGSSILPECILISSLIIILLIDLTSEKKTYWLYFISLTSLIISITVLLFQLKEEPIFSFS
GSFQTDGFNGIFRISIAFSSLLCIPLSMEYMKCTKMAITESLIFLLTATIGGMFLCGANDLIIIFITLEC
LSLSSYLLSGYTKKDVRSNEAAMKYLLMGGASSSILAYGFSWLYGLSGGKIQLQEIFNGLINTQMYNSTS
ISIVLIFIIAGIAFKLSLVPFHQWTPDVYEGAPTSVIAFFSVTSKIAGLALATRIFNTVFFSSLNEWHLI
LEIIAILSMILGNFIAITQTSMKRMLAYSSISQIGYFMIGVIAGDSNGYASMITYMLFYIFMNLGTFACI
TLFGLRTGTDNIRDYAGLYKKDPLLASFLALSLLSLGGIPPLAGFFGKLYLFWCGWKAGLYLSVSVGLFT
SVISIYYYLRIVKLIVTKENEETTSYIRKYKTSSNYLVSKSPIEFSIIICVIGSTFSGIVINPVIAIVEK
TISLSSFINN
			
    Run BLAST
 
CDS  
ATGAAATTAGATTTTGGTTCATTTTTATCAGATGGAAGTAGTATTTTACCAGAATGTATTTTAATTTCTA
GTTTAATTATCATTCTATTGATAGATCTAACCTCTGAAAAAAAGACATATTGGTTATATTTCATTTCATT
AACAAGTTTGATCATAAGTATAACTGTCCTGTTATTTCAATTAAAGGAAGAACCTATTTTTAGTTTCTCA
GGCAGTTTTCAAACAGACGGTTTTAATGGAATATTCCGAATCTCTATTGCATTTCCGTCACTTCTATGTA
TTCCCTTATCTATGGAATATATGAAATGTACAAAAATGGCGATTACTGAATCTTTAATTTTTTTGTTAAC
AGCTACTACAGGAGGAATGTTTTTATGCGGTGCTAATGATTTAATAATAATATTTATTACTCTAGAATGT
TTAAGTTTATCCTTCTATTTATTATCCGGATATACTAAGAAAGATGTATGATTCAATGAAGCTGCTATGA
AGTATTTACCTATGGGTGGAGCAAGTTCTCCCATTCTGGCTTATGGTTCTTCATGGTTATACGGTTTATC
TGGGGGGAAAATCCAACTTCAAGAGATTCTTAATGGTCTTATAAACACACAAATGTATAACTCTACAAGT
ATTTCGATCGTGCTTATATTTATTATTGCAGGAATCGCATTCAAACTTTCTTTAGTACCTTTTCATCAAT
GGACTCCTGATGTATATGAAGGAGCCCCTACCTCAGTCATTGCTTTCTTTTCTGTTACTTCAAAAATAGC
CGGTTTAGCTTTAGCTACTAGAATCTTCAACACAGTTTTTTTTTCATCACTGAACGAGTGGCATCTAATT
CTAGAAATAATAGCTATTCTAAGTATGATCTTAGGTAATTCTATTGCTATAACGCAAACAAGTATGAAAC
GTATGCTTGCATATTCTTTGATAAGTCAAATTGGATATTTTATGATTGGAGTAATTGCGGGAGACTCTAA
TGGGTATGCAAGCATGATAACTCACATGCTATTCTACATTCTTATGAATCTAGGAACTTTTGCTTGTATT
ACATTATTCGGTTTACGCACTGGAACGGACAACATTCGGGATTATGCAGGGTCATATAAAAAAGATCTTC
TATTGGCATCTTTTCCTGCTTTATCTTTATTATCCTTAGGAGGTATTCCTCCCTTAGCTGGGTTTTTCGG
AAAACCTTACCTCTCTTGGTGTGGGTGGAAAGCGGGTCTATACTTATCAGTCTCCGTAGGACTTTTCACA
AGTGTAATCTCTATATATTACTATTTACGAATAGTCAAATTGATTGTGACTAAGGAAAACGAAGAAACAA
CTTCTTATATTCGGAAGTATAAAACTTCTTTGAATTATTTAGTATCAAAAAGTCCTATTGAATTTAGTAT
CATTATATGTGTAATAGGATCAACCTCTTCGGGAATAGTGATTAACCCCGTCATTGCTATTGTTGAAAAA
ACAATATCTCTAAGTAGTTTTATTAATAACTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 265 C -> U 359 C -> U 434 U -> C 469 U -> C 473 U -> C 500 C -> U 520 C -> U 539 C -> U 589 C -> U 158 C -> U 206 U -> C 280 C -> U 298 C -> U 380 C -> U 395 U -> C 413 C -> U 473 C -> U 482 C -> U 638 U -> C 704 C -> U
 
 Edited sequence 

AUGAAAUUAGAUUUUGGUUCAUUUUUAUCAGAUGGAAGUAGUAUUUUACCAGAAUGUAUUUUAAUUUCUA GUUUAAUUAUCAUUCUAUUGAUAGAUCUAACCUCUGAAAAAAAGACAUAUUGGUUAUAUUUCAUUUCAUU AACAAGUUUGAUCAUAAGUAUAACUGUCCUGUUAUUUCAAUUAAAGGAAGAACCUAUUUUUAGUUUCUCA GGCAGUUUUCAAACAGACGGUUUUAAUGGAAUAUUCCGAAUCUCUAUUGCAUUUUCGUCACUUCUAUGUA UUCCCUUAUCUAUGGAAUAUAUGAAAUGUACAAAAAUGGCGAUUACUGAAUCUUUAAUUUUUUUGUUAAC AGCUACUAUAGGAGGAAUGUUUUUAUGCGGUGCUAAUGAUUUAAUAAUAAUAUUUAUUACUCUAGAAUGU UUAAGUUUAUCCUCCUAUUUAUUAUCCGGAUAUACUAAGAAAGAUGUACGAUCCAAUGAAGCUGCUAUGA AGUAUUUACUUAUGGGUGGAGCAAGUUCUUCCAUUCUGGCUUAUGGUUUUUCAUGGUUAUACGGUUUAUC UGGGGGGAAAAUCCAACUUCAAGAGAUUUUUAAUGGUCUUAUAAACACACAAAUGUAUAACUCUACAAGU AUUUCGAUCGUGCUUAUAUUUAUUAUUGCAGGAAUCGCAUUCAAACUUUCUUUAGUACCUUUUCAUCAAU GGACUCCUGAUGUAUAUGAAGGAAUGAAAUUAGAUUUUGGUUCAUUUUUAUCAGAUGGAAGUAGUAUUUU ACCAGAAUGUAUUUUAAUUUCUAGUUUAAUUAUCAUUCUAUUGAUAGAUCUAACCUCUGAAAAAAAGACA UAUUGGUUAUAUUUCAUUUCAUUAACAAGUUUGAUCAUAAUUAUAACUGUCCUGUUAUUUCAAUUAAAGG AAGAACCUAUUUUUAGUUCCUCAGGCAGUUUUCAAACAGACGGUUUUAAUGGAAUAUUCCGAAUCUCUAU UGCAUUUCCGUCACUUCUAUGUUUUCCCUUAUCUAUGGAAUAUAUGAAAUGUACAAAAAUGGCGAUUACU GAAUCUUUAAUUUUUUUGUUAACAGCUACUACAGGAGGAAUGUUUUUAUGCGUUGCUAAUGAUUUAACAA UAAUAUUUAUUACUCUAGAAUGUUUAAGUUUAUCCUUCUAUUUAUUAUCCGGAUAUACUAAGAAAGAUGU AUGAUUCAAUGAAGUUGCUAUGAAGUAUUUACCUAUGGGUGGAGCAAGUUCUCCCAUUCUGGCUUAUGGU UCUUCAUGGUUAUACGGUUUAUCUGGGGGGAAAAUCCAACUUCAAGAGAUUCUUAAUGGUCUUAUAAACA CACAAAUGUAUAACUCUACAAGUAUUUCGACCGUGCUUAUAUUUAUUAUUGCAGGAAUCGCAUUCAAACU UUCUUUAGUACCUUUUCAUCAAUGGAUUCCUGAUGUAUAUGAAGGAGCCCCUACCUCAGUCAUUGCUUUC UUUUCUGUUACUUCAAAAAUAGCCGGUUUAGCU