Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   280
Gene name   cysA
Locus   AnfoCp022
Organism   Anthoceros formosae
Location Start:End   43571:44716
 
Protein  
MSILVYEVSKSLGNLKVLDRVSLYVRKVSLVALLGPSGSGKSSLLRIIAGLDSPDYGSVWLHGTDMTNTS
TQYRHMAFVFQHYALFKNMTVYENISFGLRLRGFSYQKIRNKVNDLLDCLRISDIVSEYPGKLSGGQKQR
VALARSLAIKSDFLLLDEPFGALDGELRRHLSKWLKRYLKDNGITTIMVTHDQKEAISMADEIVVLKQGR
FLQQGRSKNLYDEPIDYFVGIFSGSFIEFPQLEESLDAPLGSSSSSSSSTKKSMEKDFTPFIPDLIWSQI
FTNQSIHHYHFFLRPHELYLESQIDLKAIPVQIKKIIYKRTFVQLDLSITPSSWNITIPIGYQAFRKLNI
QSFVQKLYIKPRNQVYLRAYPKKKNIISKQI
			
    Run BLAST
 
CDS  
ACGAGTATTCCTGTGTATGAAGTTTCCAAATCACTAGGTAATTTAAAAGTTCCGGATCGAGTAAGTTTAT
ATGTTCGTAAAGTTTCTTTGGTAGCTTTTTCAGGTCCCTCAGGTTCAGGAAAATCAAGTTTGTTACGAAT
AATAGCGGGTCTTGACAGTCCTGATTACGGAAGTGTATGGTTGCATGGTACAGATATGACTAATACTTCT
ACTTAATATCGACACATGGCTTTTGTTTCTCAACATTATGCTCTTTCCAAAAATATGACTGTTTATGAAA
ATACTTCTTTTGGACTTCGTTTAAGAGGATTTTCCTACCAGAAAATTAGAAATAAAGTAAATGATTTGTT
AGATTGTCTTTGAATTCCAGACATTGTGTCTGAGTATCCGGGAAAATTATCAGGGGGACAGAAACAACGT
GTTGCTCTTGCTAGAAGTCTGGCTATTAAATCAGATTTTCCTTCACCGGACGAGCCTTTTGGAGCCTCAG
ATGGAGAATTGTGAAGACACCTTAGTAAATGGTTAAAGCGTTACTTGAAAGACAATGGAATTACAACAAT
TATGGTTACTCATGATTAAAAAGAAGTTATTTCTATGGCTGACGAAATTGTGGTTTTGAAGCAAGGTCGT
TTCTTGCAACAAGGAAGATCCAAAAATCTTTATGATGAACCAATTGATTATTTTGTTGGTATTTTTCCAG
GATCATTCATTGAATTTCCTCAATTAGAAGAATCTTTGGATGCTCCACTTGGTAGTAGTAGTAGTAGTAG
TAGTAGTACTAAAAAATCCATGGAAAAAGATTTCACGCCATTTATTCCTGATCTAATATGGTCTCAAATA
TTTACTAATCAATCGATACATCACTATCATTTTTTTCTAAGACTTCATGAACTGTATCTAGAATCTCAAA
TAGATTTGAAAGCAATACCTGTTCAAATAAAAAAAATTATTTATAAAAGGACTTTCGTTCAATTAGATTT
ATCTATAACTCCTTCTTCATGGAACATTACTATTCCCATAGGTTATCAAGCCTTTTGAAAATTAAATATT
CAATCTTTCGTGCAGAAGCTCTATATAAAGCCTAGAAATCAAGTTTATTTACGGGCTTATCCCAAGAAAA
AAAACATCATTAGTAAACAAATCTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 2 C -> U 11 C -> U 53 C -> U 97 U -> C 101 C -> U 214 U -> C 239 C -> U 257 C -> U 284 C -> U 361 U -> C 367 C -> U 461 C -> U 464 C -> U 466 C -> U 467 C -> U 488 C -> U 502 U -> C 577 U -> C 587 U -> C 697 C -> U 884 U -> C 1036 U -> C
 
 Edited sequence 

AUGAGUAUUCUUGUGUAUGAAGUUUCCAAAUCACUAGGUAAUUUAAAAGUUCUGGAUCGAGUAAGUUUAU AUGUUCGUAAAGUUUCUUUGGUAGCUCUUUUAGGUCCCUCAGGUUCAGGAAAAUCAAGUUUGUUACGAAU AAUAGCGGGUCUUGACAGUCCUGAUUACGGAAGUGUAUGGUUGCAUGGUACAGAUAUGACUAAUACUUCU ACUCAAUAUCGACACAUGGCUUUUGUUUUUCAACAUUAUGCUCUUUUCAAAAAUAUGACUGUUUAUGAAA AUAUUUCUUUUGGACUUCGUUUAAGAGGAUUUUCCUACCAGAAAAUUAGAAAUAAAGUAAAUGAUUUGUU AGAUUGUCUUCGAAUUUCAGACAUUGUGUCUGAGUAUCCGGGAAAAUUAUCAGGGGGACAGAAACAACGU GUUGCUCUUGCUAGAAGUCUGGCUAUUAAAUCAGAUUUUCUUUUAUUGGACGAGCCUUUUGGAGCCUUAG AUGGAGAAUUGCGAAGACACCUUAGUAAAUGGUUAAAGCGUUACUUGAAAGACAAUGGAAUUACAACAAU UAUGGUUACUCAUGAUCAAAAAGAAGCUAUUUCUAUGGCUGACGAAAUUGUGGUUUUGAAGCAAGGUCGU UUCUUGCAACAAGGAAGAUCCAAAAAUCUUUAUGAUGAACCAAUUGAUUAUUUUGUUGGUAUUUUUUCAG GAUCAUUCAUUGAAUUUCCUCAAUUAGAAGAAUCUUUGGAUGCUCCACUUGGUAGUAGUAGUAGUAGUAG UAGUAGUACUAAAAAAUCCAUGGAAAAAGAUUUCACGCCAUUUAUUCCUGAUCUAAUAUGGUCUCAAAUA UUUACUAAUCAAUCGAUACAUCACUAUCAUUUUUUUCUAAGACCUCAUGAACUGUAUCUAGAAUCUCAAA UAGAUUUGAAAGCAAUACCUGUUCAAAUAAAAAAAAUUAUUUAUAAAAGGACUUUCGUUCAAUUAGAUUU AUCUAUAACUCCUUCUUCAUGGAACAUUACUAUUCCCAUAGGUUAUCAAGCCUUUCGAAAAUUAAAUAUU CAAUCUUUCGUGCAGAAGCUCUAUAUAAAGCCUAGAAAUCAAGUUUAUUUACGGGCUUAUCCCAAGAAAA AAAACAUCAUUAGUAAACAAAUCUAA