Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   276
Gene name   chlB
Locus   AnfoCp016
Organism   Anthoceros formosae
Location Start:End   24839:26380
 
Protein  
MKLAYWMYAGPAHIGTLRVASSFKNVHAIMHAPLGDDYFNVMRSMLERERDFTPVTASIVDRHVLARGSQ
EKVVDNIMRKDKEECPDLIVLTPTCTSSILQEDLQNFVDRASISVNSDVILADVNHYRVNELQAADRTLE
QIVRYYLDKARRQGKLNQSITDVPSANIIGIFTLGFHNQHDCRELKRLLKDLGIKINQVIPEGGFVEDLE
KLPKAWFNLIPYREVGLMTAIYLEKEFGMPYVSITPMGIADIVQCIRQIQKRVNTWTHFLLNQKLDYELY
IDQQTRFISQAAWFSRSIDCQNLTGKKAVVFGDATHASSMTKILAQEMGIRVSCAGTYCKHDAEWFEEQV
QGFCDEILITDDHTQVGDTIARIEPSAIFGTQMERHIGKRLDIPCGVISSPVHIQNFPLGYRPFLGYEGT
NQIADLVYNSFTLGMEDHLLEIFGGHDTKEVITKSLSTDNDLTWNSESQLELNKIPGFVRGKIKRNTERF
ARQNGITGITVEVMYAAKEALNA
			
    Run BLAST
 
CDS  
ATGAAATTAGCTTATTGGATGTACGCTGGCCCTGCTCACATTGGAACGCTTCGGGTAGCCAGTTCCTTTA
AAAATGTTCATGCTATTATGTATGCCTTTTTAGGAGATGACTATTTCAATGTTATGCGTTCCATGTTAGA
AAGAGAAAGAGATTTTACTTCTGTAACTGCTAGTATAGTGGATCGACATGTTTTAGCACGTGGATCTCAA
GAAAAAGTTGTTGATAATATTATGAGAAAAGATAAGGAAGAATGTCCTGATTTAATCGTATCAACACTCA
CATGTACTTCTAGTATTTCACAGGAAGATTCACAGAATTTTGTTGATAGAGCATCTATTAGTGTTAATTC
TGATGTAATTTCGGCAGATGTAAATCATCATTGAGTTAATGAACTTTAAGCAGCAGATTGAACTTTGGAA
TAAATAGTTCGATATTACTTAGATAAGGCTCGTAGACAGGGAAAGTTGAATCAATCTATAACAGATGTAC
CTTCTGCGAATATTATTGGTATTTCCACATTAGGCTTTCACAACCAACACGATTGTCGTGAATTGAAACG
TCTATTAAAAGATTTAGGCATAAAAATTAACCAAGTAATTCCTGAAGGGGGATTTGTAGAAGATTTAGAA
AAATTACCAAAAGCTTGGTTTAATTCAATTCCCTATCGTGAGGTAGGCTTAATGACGGCAATTTATTTGG
AAAAGGAATTTGGTATGCCTTACGTATCTATAACTCTTATGGGAATTGCAGATATTGTTCAATGTATCTG
ACAGATACAGAAACGCGTTAATACATGGACTCACTTTTTGTTGAATCAAAAACTTGATTATGAACTTTAT
ATTGATTAGTAAACAAGATTTATTTCTCAAGTTGCTTGGTTTTCAAGATCCATCGATTGCCAGAATTTAA
CAGGAAAAAAAGCAGTGGTTTTTGGTGATGCAACTCATGCCAGTTCAATGACTAAGATACTTGCTCAAGA
AATGGGAATTCGTGTAAGTTGTGCAGGTACTTATTGTAAACACGACGCAGAATGGTTTGAGGAGCAAGTT
CAGGGTTTCTGTGATGAGATACTCATTACAGATGATCATACTCAAGTTGGAGATACAATTGCTCGTATAG
AACCATCAGCTACTTTTGGTACTCAAATGGAACGTCATATAGGTAAACGTCTTGATATTCCCTGCGGAGT
TATTTCTTCACTAGTTCATATACAGAATCTTCCTTTAGGTTATCGACCCTTTTTGGGCTATGAAGGGACC
AATCAAATAGCTGATTTGGTTTACAATTCATTCACTTTAGGTATGGAAGATCATCTCTTAGAAATTTTTG
GTGGTCATGACACTAAAGAAGTAATAACTAAATCATTATCGACAGATAATGATTTAACTTGGAATTCAGA
AAGTCAACTTGAATCAAATAAAATTCCTGGTTTTGTTAGAGGTAAAATAAAAAGAAATACAGAGAGATTT
GCACGACAAAATGGTATCACAGGCATAACAGTAGAAGTAATGTATGCTGCTAAAGAAGCCTTAAATGCTT
AG
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 91 U -> C 97 U -> C 98 U -> C 160 U -> C 272 C -> U 278 U -> C 299 C -> U 311 C -> U 362 C -> U 379 C -> U 382 U -> C 397 U -> C 409 U -> C 421 U -> C 515 C -> U 562 C -> U 656 C -> U 737 U -> C 769 U -> C 847 U -> C 850 U -> C 872 U -> C 1133 C -> U 1202 U -> C 1219 C -> U 1415 C -> U
 
 Edited sequence 

AUGAAAUUAGCUUAUUGGAUGUACGCUGGCCCUGCUCACAUUGGAACGCUUCGGGUAGCCAGUUCCUUUA AAAAUGUUCAUGCUAUUAUGCAUGCCCCUUUAGGAGAUGACUAUUUCAAUGUUAUGCGUUCCAUGUUAGA AAGAGAAAGAGAUUUUACUCCUGUAACUGCUAGUAUAGUGGAUCGACAUGUUUUAGCACGUGGAUCUCAA GAAAAAGUUGUUGAUAAUAUUAUGAGAAAAGAUAAGGAAGAAUGUCCUGAUUUAAUCGUAUUAACACCCA CAUGUACUUCUAGUAUUUUACAGGAAGAUUUACAGAAUUUUGUUGAUAGAGCAUCUAUUAGUGUUAAUUC UGAUGUAAUUUUGGCAGAUGUAAAUCAUUAUCGAGUUAAUGAACUUCAAGCAGCAGAUCGAACUUUGGAA CAAAUAGUUCGAUAUUACUUAGAUAAGGCUCGUAGACAGGGAAAGUUGAAUCAAUCUAUAACAGAUGUAC CUUCUGCGAAUAUUAUUGGUAUUUUCACAUUAGGCUUUCACAACCAACACGAUUGUCGUGAAUUGAAACG UUUAUUAAAAGAUUUAGGCAUAAAAAUUAACCAAGUAAUUCCUGAAGGGGGAUUUGUAGAAGAUUUAGAA AAAUUACCAAAAGCUUGGUUUAAUUUAAUUCCCUAUCGUGAGGUAGGCUUAAUGACGGCAAUUUAUUUGG AAAAGGAAUUUGGUAUGCCUUACGUAUCUAUAACUCCUAUGGGAAUUGCAGAUAUUGUUCAAUGUAUCCG ACAGAUACAGAAACGCGUUAAUACAUGGACUCACUUUUUGUUGAAUCAAAAACUUGAUUAUGAACUUUAU AUUGAUCAGCAAACAAGAUUUAUUUCUCAAGCUGCUUGGUUUUCAAGAUCCAUCGAUUGCCAGAAUUUAA CAGGAAAAAAAGCAGUGGUUUUUGGUGAUGCAACUCAUGCCAGUUCAAUGACUAAGAUACUUGCUCAAGA AAUGGGAAUUCGUGUAAGUUGUGCAGGUACUUAUUGUAAACACGACGCAGAAUGGUUUGAGGAGCAAGUU CAGGGUUUCUGUGAUGAGAUACUCAUUACAGAUGAUCAUACUCAAGUUGGAGAUACAAUUGCUCGUAUAG AACCAUCAGCUAUUUUUGGUACUCAAAUGGAACGUCAUAUAGGUAAACGUCUUGAUAUUCCCUGCGGAGU UAUUUCUUCACCAGUUCAUAUACAGAAUUUUCCUUUAGGUUAUCGACCCUUUUUGGGCUAUGAAGGGACC AAUCAAAUAGCUGAUUUGGUUUACAAUUCAUUCACUUUAGGUAUGGAAGAUCAUCUCUUAGAAAUUUUUG GUGGUCAUGACACUAAAGAAGUAAUAACUAAAUCAUUAUCGACAGAUAAUGAUUUAACUUGGAAUUCAGA AAGUCAACUUGAAUUAAAUAAAAUUCCUGGUUUUGUUAGAGGUAAAAUAAAAAGAAAUACAGAGAGAUUU GCACGACAAAAUGGUAUCACAGGCAUAACAGUAGAAGUAAUGUAUGCUGCUAAAGAAGCCUUAAAUGCUU AG