Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   275
Gene name   ccsA
Locus   AnfoCp079
Organism   Anthoceros formosae
Location Start:End   128424:129443
 
Protein  
MILINLEHILAHISFFLPFLATLVFWGRIVCIDNKRIGSLGNKSIIIAYICITGLLLTRWFHSRHLLLSN
LYESFMFLSWSFCLIHIVSEIGSKNDWLGIIIVLIAMLTHGFATVGLPIEMQQSTVLVPALQSHWLIMHV
SMMIPSYATLPCGSLLVIALLITTLNKNKNFPILKFNVNSFIWSLILEKKFYLGGSGGDISSRNSSSGNG
SDNDSNNNNNKKTFHSLSIDCRKLQLTQQLDYWSYRIISLGSLFLTIGILSGAVWVNEAWGSYWSWDPKE
TWALITWLLSAIHIHIRMIRGWQGEKPAIIASSGSSIVWFRYLGVNSPEKGLHSYGWLN
			
    Run BLAST
 
CDS  
ACGATATTAATAAATCTAGAACATATATTAGCTCATATTCCTTTCTTTCTTCCTTTTCTCGCAACTTTGG
TTTTTTGGGGAAGAATTGTTTGTATAGACAATAAAAGAATAGGTTCTTTAGGTAATAAAAGCATAATAAT
CGCTTATATTTGTATAACGGGGCTTCTACTGACTCGCCGGTTCCATCCTAGACACTTACTGCTAAGTAAT
CTATATGAATCTTTTATGTTTCTTTCATGGAGTTTTTGTTTGATTCACATAGTTTCAGAAATCGGAAGTA
AAAATGATTGGTTAGGTATCATCATTGTACTGATTGCTATGTTAACCCATGGTTTTGCTACTGTGGGTCT
CCCCATAGAGATGCAACAATCTACAGTTTTAGTACCTGCCTCACAATCTCATTGGTTAATAATGCACGTA
AGTATGATGATACCTAGTTATGCCACTCTTCCATGTGGATCTTTATTAGTAATAGCTTTGTCAATTACTA
CGTTAAATAAAAATAAAAATTTTCCTATATTAAAATTTAACGTAAATTCATTTATTTGGTCTCTAATTTT
GGAAAAGAAATTTTATTTAGGAGGAAGTGGTGGAGATATAAGTAGTAGGAATAGCAGTAGTGGTAATGGG
AGTGATAATGATAGTAATAATAATAATAATAAAAAGACTTTTCATTCGCTATCTATAGATTGTCGTAAAT
TGCAATTAACTTAATAGTTGGATTATTGGAGTTATCGAATTATTAGTTTAGGTTCTTCGTTTTTAACTAT
AGGTATTCTCTCTGGAGCAGTATGGGTTAATGAAGCTTGGGGATCTTACTGGAGTTGGGATCCTAAGGAA
ACTTGGGCTTTAATTACTTGGCTTCTATCTGCAATTCATATACATATCAGAATGATTAGGGGTTGGCAGG
GTGAAAAACCAGCAATTATAGCGTCTTCAGGATCTTCTATAGTTTGGTTTCGCTACTTAGGAGTCAACTC
CCCTGAAAAAGGTTTGCATAGTTATGGCTGGTTAAATTGA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 2 C -> U 40 C -> U 178 C -> U 187 C -> U 392 C -> U 482 C -> U 712 U -> C 715 U -> C 758 C -> U
 
 Edited sequence 

AUGAUAUUAAUAAAUCUAGAACAUAUAUUAGCUCAUAUUUCUUUCUUUCUUCCUUUUCUCGCAACUUUGG UUUUUUGGGGAAGAAUUGUUUGUAUAGACAAUAAAAGAAUAGGUUCUUUAGGUAAUAAAAGCAUAAUAAU CGCUUAUAUUUGUAUAACGGGGCUUCUACUGACUCGCUGGUUCCAUUCUAGACACUUACUGCUAAGUAAU CUAUAUGAAUCUUUUAUGUUUCUUUCAUGGAGUUUUUGUUUGAUUCACAUAGUUUCAGAAAUCGGAAGUA AAAAUGAUUGGUUAGGUAUCAUCAUUGUACUGAUUGCUAUGUUAACCCAUGGUUUUGCUACUGUGGGUCU CCCCAUAGAGAUGCAACAAUCUACAGUUUUAGUACCUGCCUUACAAUCUCAUUGGUUAAUAAUGCACGUA AGUAUGAUGAUACCUAGUUAUGCCACUCUUCCAUGUGGAUCUUUAUUAGUAAUAGCUUUGUUAAUUACUA CGUUAAAUAAAAAUAAAAAUUUUCCUAUAUUAAAAUUUAACGUAAAUUCAUUUAUUUGGUCUCUAAUUUU GGAAAAGAAAUUUUAUUUAGGAGGAAGUGGUGGAGAUAUAAGUAGUAGGAAUAGCAGUAGUGGUAAUGGG AGUGAUAAUGAUAGUAAUAAUAAUAAUAAUAAAAAGACUUUUCAUUCGCUAUCUAUAGAUUGUCGUAAAU UGCAAUUAACUCAACAGUUGGAUUAUUGGAGUUAUCGAAUUAUUAGUUUAGGUUCUUUGUUUUUAACUAU AGGUAUUCUCUCUGGAGCAGUAUGGGUUAAUGAAGCUUGGGGAUCUUACUGGAGUUGGGAUCCUAAGGAA ACUUGGGCUUUAAUUACUUGGCUUCUAUCUGCAAUUCAUAUACAUAUCAGAAUGAUUAGGGGUUGGCAGG GUGAAAAACCAGCAAUUAUAGCGUCUUCAGGAUCUUCUAUAGUUUGGUUUCGCUACUUAGGAGUCAACUC CCCUGAAAAAGGUUUGCAUAGUUAUGGCUGGUUAAAUUGA