Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   274
Gene name   atpI
Locus   AnfoCp008
Organism   Anthoceros formosae
Location Start:End   15107:15853
 
Protein  
MYSAQSSISKLTNLCEISSVEVGQHFYWQIGGFQVHAQVLITSWIVIAILLGLAILATQNLQTIPTSGQN
FVEYILEFIRDLTRTQIGEEEYRPWVPFIGTMFLFIFVSNWSGALLPWRIFELPHGELAAPTNDINTTVA
LALPTSVAYFYAGLRKKGLSYSGKYIQPTPILLPINILEDFTKPLPLSFRLFGNILADELVVAVPISLVP
LVVPIPMMFLGLFTSAIQALIFATLAAAYIGESMEGHH
			
    Run BLAST
 
CDS  
ATGTATAGTGCACAATCTTCCATTAGCAAACTCACTAATTTATGCGAGATATCTAGTGTGGAAGTAGGTT
AACATTTCTACTGGCAAATAGGTGGTTTTCAGGTTTATGCATAGGTACCTATAACTTCCCGGATCGTTAT
TGCAATTTTATTAGGTTCAGCTACTTTAGCCACTTAGAATTTACAGACTATTCCAACTAGTGGTCAAAAC
TTTGTCGAATATATTTTAGAATTCATTCGAGATTTGACTAGAACTTAAATAGGAGAAGAGGAATACCGTC
CTTGGGTTCCTTTCATTGGAACTATGTTTCTTCCCACTTTCGTTTCTAATTGGTCAGGCGCTCCCCTCCC
CTGGAGAATTTTTGAATTACCTCACGGAGAATTAGCTGCACCTACAAATGATATTAATACTACTGTTGCT
TCAGCTTTGCCTACACCAGTAGCATATTTCTATGCAGGTCTTCGTAAAAAAGGTTTAAGTTATTCTGGTA
AGTATATTCAACCAACCCCGATACTTCTACCGATCAATATTCTAGAAGATTTCACTAAACTTTTACCACT
TAGTTTTCGACTCTTTGGAAATATATTAGCTGATGAGTTAGTAGTTGCTGTTCCTATTTCTTTAGTACCT
CTAGTTGTTCCTATACCTATGATGTTTTCAGGACTATTCACAAGTGCTATTTAAGCTTTAATTTCTGCGA
CTTTAGCTGCAGCTTATATTGGAGAATCAATGGAGGGTCATCATTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 70 U -> C 106 U -> C 112 U -> C 119 C -> U 130 C -> U 158 C -> U 164 C -> U 175 U -> C 256 U -> C 313 C -> U 314 C -> U 317 C -> U 344 C -> U 422 C -> U 436 C -> U 551 U -> C 659 C -> U 682 U -> C 695 C -> U
 
 Edited sequence 

AUGUAUAGUGCACAAUCUUCCAUUAGCAAACUCACUAAUUUAUGCGAGAUAUCUAGUGUGGAAGUAGGUC AACAUUUCUACUGGCAAAUAGGUGGUUUUCAGGUUCAUGCACAGGUACUUAUAACUUCCUGGAUCGUUAU UGCAAUUUUAUUAGGUUUAGCUAUUUUAGCCACUCAGAAUUUACAGACUAUUCCAACUAGUGGUCAAAAC UUUGUCGAAUAUAUUUUAGAAUUCAUUCGAGAUUUGACUAGAACUCAAAUAGGAGAAGAGGAAUACCGUC CUUGGGUUCCUUUCAUUGGAACUAUGUUUCUUUUCAUUUUCGUUUCUAAUUGGUCAGGCGCUCUCCUCCC CUGGAGAAUUUUUGAAUUACCUCACGGAGAAUUAGCUGCACCUACAAAUGAUAUUAAUACUACUGUUGCU UUAGCUUUGCCUACAUCAGUAGCAUAUUUCUAUGCAGGUCUUCGUAAAAAAGGUUUAAGUUAUUCUGGUA AGUAUAUUCAACCAACCCCGAUACUUCUACCGAUCAAUAUUCUAGAAGAUUUCACUAAACCUUUACCACU UAGUUUUCGACUCUUUGGAAAUAUAUUAGCUGAUGAGUUAGUAGUUGCUGUUCCUAUUUCUUUAGUACCU CUAGUUGUUCCUAUACCUAUGAUGUUUUUAGGACUAUUCACAAGUGCUAUUCAAGCUUUAAUUUUUGCGA CUUUAGCUGCAGCUUAUAUUGGAGAAUCAAUGGAGGGUCAUCAUUAA