Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   273
Gene name   atpH
Locus   AnfoCp009
Organism   Anthoceros formosae
Location Start:End   16730:16975
 
Protein  
MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVV
ALALLFANPFV
			
    Run BLAST
 
CDS  
ACGAACCCTTTGATTTCTGCTGCTTCCGTTACTGCTGCTGGATTAGCTGTGGGTCTTGCTTTTATTGGAT
TTGGTGTTGGGCAGGGTACTGCTGCAGGTTAAGCTGTGGAAGGTATTGTTAGATAACCTGAAGCAGAAGG
TAAAATACGAGGTACTTCATTGTCAAGCTTAGCTTCTATGGAAGCTCTGACTATTTATGGTTTAGTCGCA
GCTCTAGCACCTCCATCTGCAAATCCTTCCGTCTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 2 C -> U 32 C -> U 62 U -> C 70 U -> C 71 U -> C 100 U -> C 119 U -> C 124 U -> C 158 C -> U 164 C -> U 176 C -> U 209 C -> U 221 C -> U 223 C -> U 224 C -> U 227 C -> U 239 C -> U
 
 Edited sequence 

AUGAACCCUUUGAUUUCUGCUGCUUCCGUUAUUGCUGCUGGAUUAGCUGUGGGUCUUGCUUCUAUUGGAC CUGGUGUUGGGCAGGGUACUGCUGCAGGUCAAGCUGUGGAAGGUAUUGCUAGACAACCUGAAGCAGAAGG UAAAAUACGAGGUACUUUAUUGUUAAGCUUAGCUUUUAUGGAAGCUCUGACUAUUUAUGGUUUAGUCGUA GCUCUAGCACUUUUAUUUGCAAAUCCUUUCGUCUAA