Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   272
Gene name   atpF
Locus   AnfoCp010
Organism   Anthoceros formosae
Location Start:End   17318:17462|18210:18619
 
Protein  
MRNLIFFVIPFHFWLPAEGFKLNTNLLETNLINLGVVLGLLVYFGKGVLNNLLDKRKQTILSTIRDAEER
YKEATDKLKQAQIRLQQAELKANEIRVNGLSEMEKEKQDLINIADEDSKRLEDSKNATIRFEEQRAIEQV
RQQVSRLALERASEVLNNCLNSELHSRMIDYHIGLLKTMGSTTE
			
    Run BLAST
 
CDS  
ATGAGAAATTTGATTTCTCTTGTTATTCCTTTTCATTTTTGGCTTCCTGCAGAGGGTTTTAAACTAAATA
CAAATCTTTTAGAAACAAATTTAATCAATTTAGGTGTTGTGCTTGGTTTATTAGTTTACTTTGGAAAGGG
AGTGTTAAATAATTTATTAGATAAGCGTAAACAGACGATTTTAAGTACTATTCGCGATGCAGAGGAACGG
TATAAAGAAGCTACTGATAAACCTAAACAAGCCCAGATTCGTTTGCAACAAGCTGAATTAAAAGCAAATG
AAATTCGAGTCAATGGACTTTCTGAAATGGAAAAAGAAAAACAGGATTTAATTAATATTGCTGATGAAGA
TTCAAAACGTTTAGAAGATTCTAAAAATGCTACTATTCGTTTCGAAGAACAGAGAGCAATTGAGTAAGTT
AGACAACAGGTTTCTCGTCTCGCATTAGAAAGAGCTTCAGAAGTTTCAAACAATTGTTTAAATAGCGAAT
TGCATTCACGCATGATTGACTATCATATTGGTCTGCTTAAGACCATGGGAAGCACAACTGAATAG
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 17 C -> U 19 C -> U 90 U -> C 68 U -> C 88 C -> U 270 U -> C 322 C -> U
 
 Edited sequence 

AUGAGAAAUUUGAUUUUUUUUGUUAUUCCUUUUCAUUUUUGGCUUCCUGCAGAGGGUUUUAAACUAAAUA CAAAUCUUUUAGAAACAAACUUAAUCAAUUUAGGUGUUGUGCUUGGUUUAUUAGUUUACUUUGGAAAGGG AGUGUAUGAGAAAUUUGAUUUCUCUUGUUAUUCCUUUUCAUUUUUGGCUUCCUGCAGAGGGUUUUAAACU AACUACAAAUCUUUUAGAAACAUAUUUAAUCAAUUUAGGUGUUGUGCUUGGUUUAUUAGUUUACUUUGGA AAGGGAGUGUUAAAUAAUUUAUUAGAUAAGCGUAAACAGACGAUUUUAAGUACUAUUCGCGAUGCAGAGG AACGGUAUAAAGAAGCUACUGAUAAACCUAAACAAGCCCAGAUUCGUUUGCAACAAGCUGAAUUCAAAGC AAAUGAAAUUCGAGUCAAUGGACUUUCUGAAAUGGAAAAAGAAAAAUAGGAUUUAAUUAAUAUUGCUGAU GAAGAUUCAAAACGUUUAGAAGAUUCUAAAAAUGCUACUAUUCGUUUCGAAGAACAGAGAGCAAU