Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   269
Gene name   atpA
Locus   AnfoCp011
Organism   Anthoceros formosae
Location Start:End   18663:20186
 
Protein  
MVNIRPDEISNIIRKQIEQYNQEVKVINIGTVLQVGDGIARIYGLDKVMAGELVEFEDGTVGIALNLESD
NVGVVLMGDGLSIQEGSSVEATGKIAQIPVSDAYLGRVVNALAQPIDGKGQIPAYEFRLIESPAPGIISR
RSVYEPMQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTILNQKGQNVICVYVAIGQKASSVAQVV
NTFEERGALEYTIVVAETADSPATLQYLAPYTGAALAEYFMYRKQHTLIIYDDLSKQAQAYRQMSLLLRR
PPGREAYPGDVFYLHSRLLERAAKLSSQLGEGSMTALPIVETQAGDVSAYIPTNVISITDGQIFLSADLF
NAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFAQFASDLDKATQNQLARGQRLREL
LKQSQSAPLAVEEQVATIYTGVNGYLDVLEVEQVKKFLVQLREYLITNKPQFVEIIRSTKVFTEQAEIIL
KEAIKEHTEFFLLQEQK
			
    Run BLAST
 
CDS  
ATGGTAAACATTCGACCCGACGAAATTAGCAATATTATTCGTAAGCAAATTGAGCAGTATAATTAGGAAG
TCAAAGTTATCAATATCGGTACTGTACTTCAGGTAGGAGATGGTATTGCATGTATATACGGTCTCGATAA
AGTTATGGCCGGTGAATTGGTAGAATCTGAAGATGGCACTGTAGGCATTGCCTTAAATTTGGAATCTGAC
AATGTTGGAGTTGTTTCAATGGGAGATGGATTGAGTATTCAGGAAGGTAGCTCCGTAGAAGCAACAGGTA
AAATTGCTCAAATTCCAGTAAGTGATGCCTATTCAGGTTGTGTCGCAAATGCGTTAGCCCAACCTATCGA
TGGTAAGGGTCAAATACCAGCTTACGAATTCAGACTCATCGAATCTCCCGCTCTCGGTATAATTTCAAGA
CGTTCTGTATATGAACTAATGCAAACAGGACTTATTGCTATTGATTCTATGATTCCTACTGGATGCGGTC
AGCGAGAATTAATTATTGGAGATAGACAGACTGGTAAAACAGCAGTAGCAACAGATACTATTCTAAATCA
GAAAGGTCAAAATGTAATATGTGTCTATGTTGCTATTGGGCAAAAAGCCTCTTCCGTAGCTCAAGTAGTT
AATACTTTTGAGGAACGTGGTGCATTGGAATATACTATTGTAGTAGCAGAAACTGCAGATTCTCCCGCTA
CTTTGCAGTATCTTGCCCCCTATACAGGAGCAGCTTCAGCAGAATACTCCATGTATCGTAAACAACATAC
TTCAATTATTTATGATGATCTTTCTAAATAAGCATAAGCTTATCGACAGATGTCTCTCTTATTAAGAAGG
CCACCGGGTCGAGAAGCATACCCAGGAGATGTTTTTTACCTGCATTCCCGTCTCTTGGAAAGAGCTGCTA
AGTTGAGTTCGCAATTAGGTGAAGGAAGTATGACTGCTTTGCCTATAGTTGAAACTCAAGCAGGAGATGT
TTCAGCTTATACTCCCACTAATGTAATTTCTATAACAGATGGACAAATATTTTTATCAGCCGATTTATCT
AATGCAGGAATTCGTCCCGCGATTAATGTAGGTATTTCTGTATCCAGAGTGGGATCTGCAGCTCAGATTA
AAGCTATGAAATAAGTGGCTGGAAAGCCTAAATTAGAATTAGCTCAATTCGCAGAATTAGAAGCTTTTGC
ACAATTTGCCTCTGATCTAGATAAAGCTACGCAGAATCAATTAGCAAGGGGTCAACGTTTACGTGAATTA
CTTAAGCAATCTTAATCAGCTCCTCTTGCTGTGGAAGAACAAGTAGCTACTATTTATACTGGAGTAAATG
GATATTCGGATGTATTGGAAGTAGAATAAGTAAAGAAATTTCTTGTTCAATTACGTGAATATTTAATAAC
AAATAAACCTCAATTTGTTGAGATTATACGTTCTACTAAGGTTTTCACAGAACAAGCTGAGATTATTTTA
AAAGAAGCTACTAAGGAACATACTGAGTTTTTTTCACTTCAAGAACAAAAGTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 64 U -> C 121 U -> C 167 C -> U 227 C -> U 314 C -> U 319 U -> C 326 C -> U 404 U -> C 437 U -> C 479 C -> U 484 U -> C 737 C -> U 749 C -> U 773 C -> U 799 U -> C 805 U -> C 992 C -> U 1049 C -> U 1132 U -> C 1148 C -> U 1273 U -> C 1337 C -> U 1357 U -> C 1481 C -> U 1505 C -> U
 
 Edited sequence 

AUGGUAAACAUUCGACCCGACGAAAUUAGCAAUAUUAUUCGUAAGCAAAUUGAGCAGUAUAAUCAGGAAG UCAAAGUUAUCAAUAUCGGUACUGUACUUCAGGUAGGAGAUGGUAUUGCACGUAUAUACGGUCUCGAUAA AGUUAUGGCCGGUGAAUUGGUAGAAUUUGAAGAUGGCACUGUAGGCAUUGCCUUAAAUUUGGAAUCUGAC AAUGUUGGAGUUGUUUUAAUGGGAGAUGGAUUGAGUAUUCAGGAAGGUAGCUCCGUAGAAGCAACAGGUA AAAUUGCUCAAAUUCCAGUAAGUGAUGCCUAUUUAGGUCGUGUCGUAAAUGCGUUAGCCCAACCUAUCGA UGGUAAGGGUCAAAUACCAGCUUACGAAUUCAGACUCAUCGAAUCUCCCGCUCCCGGUAUAAUUUCAAGA CGUUCUGUAUAUGAACCAAUGCAAACAGGACUUAUUGCUAUUGAUUCUAUGAUUCCUAUUGGACGCGGUC AGCGAGAAUUAAUUAUUGGAGAUAGACAGACUGGUAAAACAGCAGUAGCAACAGAUACUAUUCUAAAUCA GAAAGGUCAAAAUGUAAUAUGUGUCUAUGUUGCUAUUGGGCAAAAAGCCUCUUCCGUAGCUCAAGUAGUU AAUACUUUUGAGGAACGUGGUGCAUUGGAAUAUACUAUUGUAGUAGCAGAAACUGCAGAUUCUCCCGCUA CUUUGCAGUAUCUUGCCCCCUAUACAGGAGCAGCUUUAGCAGAAUACUUCAUGUAUCGUAAACAACAUAC UUUAAUUAUUUAUGAUGAUCUUUCUAAACAAGCACAAGCUUAUCGACAGAUGUCUCUCUUAUUAAGAAGG CCACCGGGUCGAGAAGCAUACCCAGGAGAUGUUUUUUACCUGCAUUCCCGUCUCUUGGAAAGAGCUGCUA AGUUGAGUUCGCAAUUAGGUGAAGGAAGUAUGACUGCUUUGCCUAUAGUUGAAACUCAAGCAGGAGAUGU UUCAGCUUAUAUUCCCACUAAUGUAAUUUCUAUAACAGAUGGACAAAUAUUUUUAUCAGCCGAUUUAUUU AAUGCAGGAAUUCGUCCCGCGAUUAAUGUAGGUAUUUCUGUAUCCAGAGUGGGAUCUGCAGCUCAGAUUA AAGCUAUGAAACAAGUGGCUGGAAAGCUUAAAUUAGAAUUAGCUCAAUUCGCAGAAUUAGAAGCUUUUGC ACAAUUUGCCUCUGAUCUAGAUAAAGCUACGCAGAAUCAAUUAGCAAGGGGUCAACGUUUACGUGAAUUA CUUAAGCAAUCUCAAUCAGCUCCUCUUGCUGUGGAAGAACAAGUAGCUACUAUUUAUACUGGAGUAAAUG GAUAUUUGGAUGUAUUGGAAGUAGAACAAGUAAAGAAAUUUCUUGUUCAAUUACGUGAAUAUUUAAUAAC AAAUAAACCUCAAUUUGUUGAGAUUAUACGUUCUACUAAGGUUUUCACAGAACAAGCUGAGAUUAUUUUA AAAGAAGCUAUUAAGGAACAUACUGAGUUUUUUUUACUUCAAGAACAAAAGUAA