Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   268
Gene name   accD
Locus   AnfoCp037
Organism   Anthoceros formosae
Location Start:End   74972:75913
 
Protein  
MSLMNWFEDRRKFSGLIGAFIEKATKGYILSERRKDRHIKIDTTKGLWTRCDNCENMLYIRFLRQNKRIC
EECGYHLQMSSTERIESLIDRGTWHPMDEDMVARDALKFSDEDSYKNRVLFYQKRTGLTDAIQTGIGKLN
GIPIALGVMDFQFMGGSMGSVVGEKITRLIEYGTRESMPVIIVCSSGGARMQEGTLSLMQMAKISAVLQI
HQAQKKLLYIAILTYPTTGGVTASFGMLGDVIIAEPKAYIAFAGKRVIEQTLRQKIPDGSQVAESLFDHG
LLDLIVPRNLLRGVLSEIFELYSSAPCRRSNNS
			
    Run BLAST
 
CDS  
ATGTCTCTAATGAATTGGTTTGAAGACAGACGCAAATTTAGTGGATTAATCGGGGCTTTCATCGAAAAAG
CAACTAAAGGGTATATCCTCAGTGAAAGAAGGAAAGACAGACATATCAAAATTGATACTACTAAAGGATT
ATGGACTTGATGCGATAACTGTGAAAATATGCTTCACATCAGATTTTTAAGACAAAATAAACGCATTTGC
GAAGAATGTGGATATCATTTGTAAATGAGTAGTACGGAAAGAATTGAATTTCTAATTGACCGTGGTACCT
GGCATCCTATGGATGAAGATATGGTTGCTTGAGACGCTTTGAAATTTTCCGATGAAGATTCCTACAAAAA
TCGGGTCCTTTTTTATCAAAAAAGAACAGGTTTAACTGATGCTACTCAAACTGGGATAGGTAAACCAAAT
GGTATTCCTATTGCACCTGGTGTTACGGATTTCCAATTTATGGGAGGTAGTATGGGTTTTGTAGTAGGAG
AAAAGATTACTCGTCTTACTGAATATGGTACTAGAGAATTAATGCCAGTAATAATAGTTTGTTTCTCTGG
AGGAGCACGTATGCAGGAAGGAACTTTGAGTTCAATGCAAATGGCTAAAATTTCTGCCGTTTCACAGATT
CATCAAGCACAAAAAAAATTATTATATATAGCTATTCCTACATATTCCACAATAGGTGGGGTTACTGCTA
GTTTTGGTATGTTGGGAGACGTGATTACTGCTGAATTTAAAGCATATATAGCTTCTGCAGGTAAAAGGGT
GATTGAATAGACGTTACGTTAAAAAATACCTGACGGTTCTCAAGTTGCTGAGTCTTTATCTGATCATGGT
TTACTTGATTTGACTGTTCCACGCAACCTTTTAAGAGGCGTCTCAAGTGAAATATTCGAACTTTATAGTT
CAGCTCCTTGTAGAAGGAGTAACAACTCGTAA
			
    Run BLAST
 
mRNA Edited   Edits at following locations: 148 U -> C 175 C -> U 232 U -> C 260 U -> C 310 U -> C 395 C -> U 416 C -> U 437 C -> U 446 C -> U 479 U -> C 509 C -> U 530 U -> C 554 U -> C 593 C -> U 623 C -> U 668 C -> U 676 U -> C 683 U -> C 728 C -> U 736 U -> C 737 U -> C 755 C -> U 778 U -> C 790 U -> C 830 C -> U 854 C -> U 884 C -> U
 
 Edited sequence 

AUGUCUCUAAUGAAUUGGUUUGAAGACAGACGCAAAUUUAGUGGAUUAAUCGGGGCUUUCAUCGAAAAAG CAACUAAAGGGUAUAUCCUCAGUGAAAGAAGGAAAGACAGACAUAUCAAAAUUGAUACUACUAAAGGAUU AUGGACUCGAUGCGAUAACUGUGAAAAUAUGCUUUACAUCAGAUUUUUAAGACAAAAUAAACGCAUUUGC GAAGAAUGUGGAUAUCAUUUGCAAAUGAGUAGUACGGAAAGAAUUGAAUCUCUAAUUGACCGUGGUACCU GGCAUCCUAUGGAUGAAGAUAUGGUUGCUCGAGACGCUUUGAAAUUUUCCGAUGAAGAUUCCUACAAAAA UCGGGUCCUUUUUUAUCAAAAAAGAACAGGUUUAACUGAUGCUAUUCAAACUGGGAUAGGUAAACUAAAU GGUAUUCCUAUUGCACUUGGUGUUAUGGAUUUCCAAUUUAUGGGAGGUAGUAUGGGUUCUGUAGUAGGAG AAAAGAUUACUCGUCUUAUUGAAUAUGGUACUAGAGAAUCAAUGCCAGUAAUAAUAGUUUGUUCCUCUGG AGGAGCACGUAUGCAGGAAGGAACUUUGAGUUUAAUGCAAAUGGCUAAAAUUUCUGCCGUUUUACAGAUU CAUCAAGCACAAAAAAAAUUAUUAUAUAUAGCUAUUCUUACAUAUCCCACAACAGGUGGGGUUACUGCUA GUUUUGGUAUGUUGGGAGACGUGAUUAUUGCUGAACCUAAAGCAUAUAUAGCUUUUGCAGGUAAAAGGGU GAUUGAACAGACGUUACGUCAAAAAAUACCUGACGGUUCUCAAGUUGCUGAGUCUUUAUUUGAUCAUGGU UUACUUGAUUUGAUUGUUCCACGCAACCUUUUAAGAGGCGUCUUAAGUGAAAUAUUCGAACUUUAUAGUU CAGCUCCUUGUAGAAGGAGUAACAACUCGUAA