Chloroplast DB
Home | Search | Blast | Tribes | Organisms | RNA Edits | Links
 
Gene View
 
ID   14108
Gene name   ndhD
Locus   GobaCp072
Organism   Gossypium barbadense
Location Start:End   122321:120819
 
Protein  
MNYFPWLTIIVFLPISAGSLLFFLPHKGNKLIKWYTICICILELLLTTYAFCYHFRLDDPLIQLAEDYKW
INFFDFYWRLGIDGLSIGPILLTGFITTLATLAAWPVTRDSRLFHFLMLAMYSGQIGSFSSRDLLLFFIM
WEFELIPVYLLLSMWGGKKRLYSATKFILYTAGGSVFLLIGVLGLGLYGSNEPTLNFETLANQSYPVALE
IIFYIGFLIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWL
IIVGTMQIIYAASTSLGQRNLKKRIAYSSVSHMGFIIIGIGSITDTGLNGAILQIISHGFIGAALFFLAG
TSYDRMRLVYLDEMGGMAVSIPKIFTMFSILSMASLALPGMSGFVAELIVFFGIITSQKYFLMPKILITF
VMAIGMILTPIYSLSMSRQMFYGYKLFNAPSSYFFDSGPRELFVSISIFLPVIGIGIYPDFVLSLSGEKV
ETILYNYFYR
			
    Run BLAST
 
CDS  
ACGAATTATTTTCCTTGGTTAACAATAATTGTATTTTTACCAATATCTGCAGGTTCTTTACTTTTCTTTC
TTCCTCATAAAGGAAATAAGCTAATTAAGTGGTATACAATATGTATATGCATTCTCGAACTCCTTCTAAC
AACCTATGCATTTTGTTATCATTTCCGATTGGACGATCCATTAATCCAGCTGGCGGAAGATTATAAATGG
ATAAATTTTTTTGATTTTTACTGGAGATTGGGAATAGATGGACTTTCTATAGGGCCCATTTTACTGACAG
GATTTATCACCACTTTAGCCACTTTGGCGGCTTGGCCAGTTACTCGAGATTCGCGATTATTTCATTTCCT
GATGCTAGCAATGTACAGTGGTCAAATAGGATCATTTTCTTCTCGAGACCTTTTACTTTTTTTCATCATG
TGGGAGTTCGAATTAATTCCCGTTTATCTACTTCTATCCATGTGGGGGGGAAAGAAACGTCTGTACTCGG
CTACAAAATTTATTTTGTACACCGCAGGGGGTTCCGTTTTTCTATTAATAGGAGTTTTGGGTCTCGGTTT
ATACGGTTCTAATGAACCAACATTAAATTTTGAAACATTAGCTAATCAATCATATCCTGTCGCACTGGAA
ATAATATTCTATATTGGATTTCTTATTGCTTTTGCTGTCAAATCGCCGATTATACCCTTACATACGTGGT
TACCGGATACCCACGGGGAGGCCCATTACAGTACTTGTATGCTTCTAGCCGGAATTTTATTAAAAATGGG
AGCATATGGATTAGTTCGGATCAATATGGAATTATTACCCCATGCGCATTCCATATTTTCTCCCTGGTTG
ATAATAGTGGGTACAATGCAAATAATTTATGCAGCTTCAACATCTCTTGGTCAACGGAATTTAAAAAAAA
GAATAGCCTATTCCTCCGTATCTCATATGGGTTTCATAATTATAGGAATTGGTTCGATAACTGATACGGG
ACTCAACGGAGCTATTTTACAAATAATATCTCATGGCTTTATCGGTGCTGCACTTTTTTTCTTGGCAGGA
ACGAGTTATGATAGAATGCGTCTTGTTTATCTCGACGAAATGGGCGGAATGGCCGTTTCGATTCCCAAAA
TATTTACGATGTTCAGTATCTTATCCATGGCTTCTCTTGCATTACCGGGCATGAGTGGTTTTGTTGCAGA
ATTGATAGTCTTTTTTGGAATAATTACCAGCCAAAAATATTTTTTAATGCCAAAAATACTAATTACTTTC
GTAATGGCAATTGGAATGATATTAACTCCTATTTATTCATTATCTATGTCACGTCAAATGTTCTATGGAT
ACAAGCTATTTAATGCTCCAAGTTCTTATTTTTTTGATTCTGGACCACGAGAGTTATTTGTTTCGATCTC
TATCTTTCTACCAGTAATAGGTATTGGTATTTATCCGGATTTCGTTCTCTCATTATCAGGTGAGAAAGTC
GAAACTATTCTATATAATTATTTTTATAGATAG
			
    Run BLAST
 
mRNA Edited  
 
 Edited sequence 

AC